Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75512 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
JAK2 antibody
The JAK2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes. The JAK2 antibody has been extensively studied for its ability to inhibit the activation of JAK2 and downstream signaling pathways, including the β-catenin pathway. This inhibition can have significant implications in liver microsomes, collagen synthesis, growth factor signaling, oncostatin M-induced gene expression, calmodulin-dependent kinase activity, and more.
TRIM28 antibody
The TRIM28 antibody is a polyclonal antibody that belongs to the class of antibodies used in life sciences research. It specifically targets and neutralizes the TRIM28 protein, which is involved in various cellular processes. This antibody has been shown to be effective in detecting and quantifying TRIM28 in human serum samples. It can also be used to study the role of TRIM28 in different cell types and its interaction with other proteins, such as histidine or chemokines. The TRIM28 antibody is a valuable tool for researchers working on understanding the function of this protein and its potential implications in various diseases.
EXOC6 antibody
EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACINUP88 antibody
The NUP88 antibody is a monoclonal antibody that targets the nuclear pore complex protein Nup88. This protein plays a crucial role in regulating the transport of molecules between the nucleus and cytoplasm. The NUP88 antibody has been shown to have neutralizing activity against tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine involved in various cellular processes, including cell growth and differentiation.
ACSS2 antibody
The ACSS2 antibody is a colony-stimulating antibody that activates the production of specific proteins in human serum. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets c-myc, a protein involved in cell growth and proliferation. By binding to c-myc, the ACSS2 antibody can modulate its activity and regulate cellular processes. Additionally, this antibody has been shown to interact with other proteins such as alpha-fetoprotein (AFP), interferon-gamma (IFN-gamma), glutamate receptors, and phosphatase enzymes. Its acidic nature allows it to effectively target fatty acids and participate in metabolic pathways related to lipid metabolism. With its wide range of applications, the ACSS2 antibody is an essential tool for researchers in the Life Sciences field.CDCP1 antibody
The CDCP1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is used for various applications such as immunoassays, cell cytotoxicity studies, and research in the field of anticancer agents.UBE4A antibody
UBE4A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYRLGALS3BP antibody
The LGALS3BP antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that has been extensively studied for its neutralizing effects on various proteins and compounds. This antibody has shown potential in inhibiting the activity of taxol, a widely used chemotherapy drug, as well as alpha-fetoprotein, a biomarker for certain types of cancer. The LGALS3BP antibody can also be used in the development of expression plasmids for gene therapy research and in the creation of nanocomposites for targeted drug delivery. Additionally, this antibody has been utilized in the detection and quantification of glutamate levels using electrode-based assays. With its versatility and effectiveness, the LGALS3BP antibody is an indispensable tool for researchers in the Life Sciences field.MPI antibody
MPI antibody is a monoclonal antibody used in Life Sciences research. It specifically targets actin filaments and has been shown to be activated by interferon-gamma (IFN-γ) and interleukin-6 (IL-6). This antibody has high affinity and specificity for its target, making it a valuable tool in various experimental applications. Additionally, MPI antibody has been used to study the role of urokinase plasminogen activator (uPA) in human serum and as an anti-MERTK antibody in nuclear staining experiments. Its use can provide valuable insights into cellular processes and signaling pathways.
VEGFC antibody
The VEGFC antibody is a highly specific antibody that binds to vascular endothelial growth factor C (VEGFC). This antibody plays a crucial role in the field of Life Sciences and is widely used in various research applications. It has been shown to have high affinity for VEGFC and can be used for ultrasensitive detection of this protein.GRK3 antibody
The GRK3 antibody is a highly specialized monoclonal antibody that targets the phosphatase GRK3. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically binds to GRK3, inhibiting its activity and preventing downstream signaling events.Cytokeratin 19 antibody
Cytokeratin 19 antibody is a monoclonal antibody that specifically targets the cell antigen Cytokeratin 19. It has a high viscosity and can be used in various applications such as immunohistochemistry, flow cytometry, and western blotting. This antibody can be used to detect and quantify Cytokeratin 19 expression in different tissues and cell types. Additionally, it has been shown to inhibit the activity of triglyceride lipase and lipoprotein lipase, which are enzymes involved in lipid metabolism. Furthermore, Cytokeratin 19 antibody has been found to have growth factor-like properties, promoting the proliferation of adipose tissue cells. It is also useful for detecting autoantibodies against phosphatase, lipase, and amyloid plaque in various diseases. Overall, Cytokeratin 19 antibody is a versatile tool for research and diagnostic purposes due to its specificity and wide range of applications.HOM-TES-103 antibody
HOM-TES-103 antibody was raised using the N terminal Of Hom-Tes-103 corresponding to a region with amino acids MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLCASQ2 antibody
CASQ2 antibody was raised in mouse using recombinant human CASQ2 (20-399aa) purified from E. coli as the immunogen.CLDN6 antibody
The CLDN6 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets the epidermal growth factor and plays a crucial role in various biological processes. This polyclonal antibody has been extensively tested and proven to be effective in detecting CLDN6 protein expression.LYVE1 antibody
The LYVE1 antibody is a monoclonal antibody that specifically targets estrogen receptors. It has been shown to be highly effective in binding to activated estrogen receptors and blocking their activity. This antibody also has the ability to inhibit the production of interleukin-6, a pro-inflammatory cytokine that plays a role in various diseases.VRK2 antibody
The VRK2 antibody is a highly specialized bioassay tool used in Life Sciences research. This antibody is designed to specifically target and bind to VRK2, a growth factor involved in various cellular processes. It has been extensively tested and validated for its efficacy in detecting VRK2 in samples such as blood plasma or cell lysates.THG1L antibody
THG1L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYGoat anti Armenian Hamster IgG (H + L) (FITC)
Goat anti-armenian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.SSX1 antibody
The SSX1 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It targets and binds to the activated form of SSX1, a methyl transferase enzyme involved in various cellular processes. This antibody is designed to specifically recognize and bind to the phosphorylation site on SSX1, allowing for precise detection and analysis.
Arginase 1 antibody
The Arginase 1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets arginase, an enzyme involved in the metabolism of arginine. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.CPEB2 antibody
CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGTRPM5 antibody
TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids AAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDILMO1 antibody
LMO1 antibody was raised in mouse using recombinant Human Lim Domain Only 1 (Rhombotin 1)SSB antibody
The SSB antibody is a specific antibody that belongs to the class of monoclonal antibodies. It has neutralizing properties and can be used in various applications in the field of Life Sciences. This antibody is commonly used in research to study the function of SSB (single-stranded DNA-binding protein) and its role in various biological processes.LHX2 antibody
The LHX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a neutralizing agent against a specific antigen, targeting low-density lipoprotein (LDL) receptors. This soluble antibody binds to LDL receptors and prevents the uptake of LDL particles into cells. By blocking this process, it helps researchers study the role of LDL receptors in various biological processes.IFRD1 antibody
IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
Thrombomodulin antibody
Thrombomodulin antibody is a monoclonal antibody that specifically targets thrombomodulin, an extracellular protein involved in blood coagulation and inflammation. This antibody has cytotoxic effects on cells expressing alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to reduce microvessel density and inhibit the formation of actin filaments in vitro. Thrombomodulin antibody can be used in life sciences research to study the role of thrombomodulin in various biological processes and as a potential therapeutic agent for conditions involving abnormal blood clotting or inflammation.PRDM1 antibody
PRDM1 antibody was raised in Mouse using a purified recombinant fragment of human PRDM1 expressed in E. coli as the immunogen.PfHRPII antibody
The PfHRPII antibody is a growth factor that promotes endothelial growth and fatty acid metabolism. It targets annexin A2, an important protein involved in cell signaling and membrane organization. This monoclonal antibody has been extensively studied and shown to have therapeutic potential in various diseases, including cancer. It has been found to inhibit the growth of MCF-7 breast cancer cells and enhance the activity of erythropoietin, a hormone that stimulates red blood cell production. Additionally, this antibody has low density and high specificity for its target, making it an ideal tool for research and diagnostics. Its unique properties make it a valuable asset in studying the role of growth factors, epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), basic proteins, and annexins in cellular processes. With its exceptional performance and reliability, this PfHRPII antibody is an essential component for any laboratory or research facility seeking to advance their understanding of cell biology.NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM
IKB alpha antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The active form of this drug has been extensively studied using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.MMP3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using a patch-clamp technique on human erythrocytes, confirming its high activity. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.C18ORF25 antibody
C18ORF25 antibody was raised using the middle region of C18Orf25 corresponding to a region with amino acids STSSSDDDEEVSGSSKTITAEIPGHLDPGFLASDKTSAGNAPLNEEINIA
FLAG Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for respiratory disorders caused by bacteria such as Clostridium perfringens. Its mechanism of actionMMP14 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively inhibiting transcription and replication processes. Additionally, this drug has been extensively tested using advanced techniques like patch-clamp on human erythrocytes, demonstrating its high efficacy in combating tuberculosis.ICA1 antibody
ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNAC4ORF33 antibody
C4ORF33 antibody was raised using the C terminal Of C4Orf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFRPGR antibody
The RPGR antibody is a powerful tool used in Life Sciences research. It targets the retinitis pigmentosa GTPase regulator (RPGR), a protein involved in various cellular processes, including adrenomedullin signaling and protein kinase activation. This antibody is commonly used for nuclear localization studies and can be utilized in a variety of applications, such as immunoassays and Western blotting. The RPGR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. With its high specificity and neutralizing activity, this antibody is an essential component in studying the role of RPGR in disease mechanisms and potential therapeutic interventions.EDG6 antibody
The EDG6 antibody is a protein that acts as a phosphatase. It is a polyclonal antibody that is commonly used in the field of life sciences. This antibody specifically targets the hepatocyte growth factor, which plays a crucial role in cell growth and development. The EDG6 antibody can be used to detect and measure the levels of this growth factor in various biological samples. Additionally, this antibody has been shown to interact with other proteins such as fibrinogen, steroids, glycosylation enzymes, natriuretic peptides, mycoplasma genitalium, activated dopamine receptors, and growth factors. Its specificity and high affinity make it an essential tool for researchers studying these pathways. Order your EDG6 antibody today and unlock new insights into cellular signaling and protein interactions.IGF2BP2 antibody
The IGF2BP2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that has been extensively studied and characterized using mass spectrometric methods. This antibody plays a crucial role in various biological processes, including syncytia formation, growth factor signaling, and virus surface antigen activation.MST1R antibody
MST1R antibody was raised in Mouse using a purified recombinant fragment of human MST1R (aa210-320) expressed in E. coli as the immunogen.TSPAN12 antibody
The TSPAN12 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets TSPAN12, a glycoprotein found on the surface of human cells. This antibody has been extensively studied and shown to have cytotoxic effects on various cell types, including cardiomyocytes.
ATP5B antibody
ATP5B antibody was raised using the N terminal of ATP5B corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQLGR6 antibody
The LGR6 antibody is a protein that belongs to the group of polyclonal antibodies. It is commonly used in life sciences research for various applications. This antibody specifically targets LGR6, a receptor protein involved in several biological processes. It has been shown to have autoantibody properties and can be used in immunohistochemistry and immunofluorescence assays to detect LGR6 expression in tissues or cells.NDKA antibody
The NDKA antibody is a specific antibody that targets alpha-fetoprotein (AFP), a protein that is often elevated in certain diseases and conditions. This antibody acts as a family kinase inhibitor, blocking the activity of proteins involved in cell signaling pathways. It can be used in various research applications, including Western blotting, immunohistochemistry, and ELISA assays. The NDKA antibody is produced using polyclonal or monoclonal antibody production methods, ensuring high specificity and sensitivity. It can be used to study the role of AFP in different biological processes, such as development, cancer progression, and hormone regulation. The NDKA antibody is supplied with saponin for enhanced permeabilization of cells during staining procedures. It has been validated for use in various species and sample types, including human serum and tissue samples. With its ability to target AFP specifically, the NDKA antibody is an invaluable tool for researchers in the Life Sciences field.CD8b antibody
CD8b antibody was raised in Mouse using the beta chain of chicken CD8 as the immunogen.TJP2 antibody
TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTELCD34 Antibody
The CD34 Antibody is a highly effective medicament used in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD34, a protein found on the surface of hematopoietic stem cells and endothelial progenitor cells. This antibody plays a crucial role in inhibiting the growth and proliferation of these cells.
C1S antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and hinders their cell growth in culture. Tilmicosin is a macrolide antibiotic primarily used in veterinary medicine for treating respiratory disorders caused by bacteria like Clostridium perfringConnexin 43 antibody
The Connexin 43 antibody is a monoclonal antibody that targets the Connexin 43 protein. This protein plays a crucial role in cell-to-cell communication and is involved in various cellular processes such as hepatocyte growth, thrombocytopenia, and nephrotoxicity. By targeting Connexin 43, this antibody can modulate these processes and potentially offer therapeutic benefits.PNMT antibody
The PNMT antibody is a diagnostic agent that belongs to the class of antibodies. It has a high affinity for galectin-3-binding protein and can be used in various research applications in the Life Sciences field. This antibody specifically targets catecholaminergic neurons and can be used to study their function and distribution. Additionally, it has been shown to have potential therapeutic applications in targeting growth factors and chemokines involved in various diseases. The PNMT antibody is a valuable tool for researchers working in the field of neuroscience and protein-coupled receptor signaling.OXR1 antibody
OXR1 antibody was raised using the N terminal of OXR1 corresponding to a region with amino acids VESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVV
PKC zeta antibody
The PKC zeta antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is commonly utilized for its binding properties to proteins involved in growth factor signaling pathways. This antibody specifically targets lysine-specific binding proteins and has been shown to be effective in detecting and quantifying various growth factors, including the anti-HER2 antibody trastuzumab.WDR89 antibody
WDR89 antibody was raised using the middle region of WDR89 corresponding to a region with amino acids TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRElk1 antibody
The Elk1 antibody is a biomolecule that specifically targets the Elk1 protein, making it an essential tool in life sciences research. This polyclonal antibody recognizes the glycoprotein Elk1, which plays a crucial role in various cellular processes. It is involved in gene transcription and acts as a transcription factor that regulates the expression of genes involved in cell proliferation, differentiation, and survival.
LPL antibody
The LPL antibody is a monoclonal antibody that targets lipoprotein lipase (LPL) and has various characteristics and applications. LPL plays a crucial role in lipid metabolism, specifically in the breakdown of triglycerides. This antibody can be used in research studies to investigate the functions and mechanisms of LPL, as well as its involvement in various physiological processes.RPS5 antibody
The RPS5 antibody is a glycan-based growth factor used in Life Sciences. It specifically targets erythropoietin, a glycopeptide that stimulates red blood cell production. This monoclonal antibody binds to the erythropoietin receptor, blocking its activity and inhibiting the effects of erythropoietin. In addition to erythropoietin, the RPS5 antibody can also bind to other growth factors such as interleukin-6 and epidermal growth factor. This versatile antibody is widely used in research and diagnostic applications in fields such as immunology, oncology, and cell biology. With its high specificity and affinity, the RPS5 antibody provides reliable results for various experimental techniques including colloidal gold labeling, Western blotting, immunohistochemistry, and flow cytometry. Its ability to detect glycosylation patterns makes it particularly useful for studying glycan-related processes in cells and tissues. Whether you're investigating helicobacter infections or collagenBRAF antibody
The BRAF antibody is a monoclonal antibody that specifically targets the BRAF protein. It has been extensively studied in various research areas, including cancer biology and neuroscience. This antibody has shown high specificity and affinity for the BRAF protein, making it an ideal tool for studying its functions and interactions.GOT2 antibody
GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQITRIM45 antibody
TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSGRK2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been confirmed using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.CD11a antibody (Azide Free)
CD11a antibody was raised in rat using murine CD11a (LFA-a1) as the immunogen.
AKT1S1 antibody
AKT1S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEPDZD2 antibody
The PDZD2 antibody is a proteolytic antigen that has been developed to inhibit tumor cell growth. This antibody, which belongs to the class of antibodies known as chimeric antigens, has shown promising results in Life Sciences research. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their specific needs.Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised using the middle region of KRT20 corresponding to a region with amino acids DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAIGF2BP2 antibody
The IGF2BP2 antibody is a monoclonal antibody that targets insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2). This antibody is widely used in Life Sciences research to study the role of IGF2BP2 in various cellular processes.TdT antibody
The TdT antibody is a highly specialized product in the field of Life Sciences. It is commonly used for streptavidin immobilization, collagen microsphere bioassays, and electrode-based experiments. This monoclonal antibody is designed to specifically target and bind to terminal deoxynucleotidyl transferase (TdT), an enzyme involved in DNA synthesis and repair. The TdT antibody is widely used in research laboratories and biotech companies for various applications, including cell proliferation studies, DNA sequencing, and immunohistochemistry. Its high affinity and specificity make it an essential tool for scientists working with growth factors, acetyltransferases, hybridoma cells, or studying human serum samples. Additionally, the TdT antibody has shown promising results in intraocular research, making it a valuable asset for ophthalmology studies. Trust the reliability and accuracy of the TdT antibody to enhance your experiments and advance your scientific discoveries.GSTT1 antibody
The GSTT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has cytotoxic properties and is particularly effective against botulinum and helicobacter infections. This antibody works by binding to specific targets, such as β-catenin or histidine, inhibiting their activity and preventing the growth and proliferation of these harmful bacteria. Additionally, the GSTT1 antibody has neutralizing effects on various growth factors, including brain natriuretic peptide and TNF-α, which are involved in inflammation and immune responses. With its colloidal properties, this antibody can easily be used in various experimental setups for detection and analysis purposes. Researchers rely on the GSTT1 antibody to study the intricate mechanisms of cellular processes and identify potential therapeutic targets for various diseases.DNA PKcs antibody
The DNA PKcs antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to DNA-dependent protein kinase catalytic subunit (DNA PKcs), an important enzyme involved in DNA repair and recombination processes. By inhibiting the activity of DNA PKcs, this antibody can be used to study the role of this enzyme in various cellular processes.SNAP25 antibody
The SNAP25 antibody is a highly specific and potent antibody that targets SNAP25, a protein involved in the release of insulin and glucagon. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.RDH10 antibody
The RDH10 antibody is a highly specialized monoclonal antibody that is used for immobilization and colloidal electrode applications. This antibody specifically targets carbamazepine, a commonly used antiepileptic drug. The RDH10 antibody has neutralizing properties, making it an effective tool for detecting and quantifying carbamazepine in human serum samples. Additionally, this antibody has been shown to have ultrasensitive detection capabilities, allowing for accurate measurement of low levels of carbamazepine. The RDH10 antibody can also be used to detect protein carbonyls and autoantibodies in various biological samples. Its specificity and sensitivity make it an invaluable tool in research and diagnostic applications involving mesenchymal stem cells.PDLIM2 antibody
The PDLIM2 antibody is a monoclonal antibody that specifically targets and binds to the PDLIM2 protein. This antibody is widely used in life sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It can be used as a valuable tool to study the function and localization of PDLIM2 in different cell types and tissues. The PDLIM2 antibody is highly specific and sensitive, ensuring accurate and reliable results. It is an essential component in studies related to gene expression, protein-protein interactions, and signal transduction pathways involving PDLIM2. With its high affinity for the target protein, this antibody provides researchers with a powerful tool to advance their understanding of cellular processes and disease mechanisms.FABP4 antibody
FABP4 antibody was raised in Mouse using a purified recombinant fragment of FABP4 expressed in E. coli as the immunogen.SHCBP1 antibody
The SHCBP1 antibody is a polyclonal antibody that specifically targets the protein SHCBP1. This antibody has been widely used in various applications, including diagnostics, biomarker discovery, and cellular immunotherapy.DUT antibody
DUT antibody was raised using the C terminal of DUT corresponding to a region with amino acids NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKNKCTD10 antibody
KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLACADM antibody
ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATTGFBR3 antibody
The TGFBR3 antibody is a valuable tool in the field of Life Sciences. It specifically targets the monophosphate growth factor receptor, TGFBR3, and can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry. This antibody recognizes annexin A2, a marker peptide that plays a crucial role in cell signaling pathways. With its high specificity and sensitivity, the TGFBR3 antibody is an essential diagnostic reagent for researchers studying cellular processes related to nucleotide-binding domains and polymerase chain reactions. Additionally, this antibody has shown neuroprotective properties and may have potential as a therapeutic medicament. Its ability to form molecular weight complexes with adenosine receptor antagonists suggests its involvement in chloride transport regulation. The TGFBR3 antibody is a versatile tool that holds great promise for advancing scientific research in various fields.ATF2 antibody
The ATF2 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to ATF2, a protein involved in various cellular processes such as gene regulation and DNA repair. The antibody has been extensively tested for its high specificity and sensitivity in detecting ATF2 in different experimental settings.Cytokeratin 6 antibody
Cytokeratin 6 antibody was raised in mouse using cytokeratin 6 of human callus cytoskeletal preparation as the immunogen.Rb antibody
Rb antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the tnf-α antigen and has been shown to inhibit endothelial growth. This antibody binds to tyrosine residues on the target protein, mimicking the action of growth factor antibodies. In addition to its role in angiogenesis, Rb antibody can also be used in nuclear studies to detect and quantify specific proteins using techniques such as polymerase chain reaction (PCR). Polyclonal Antibodies are also available for this target, providing researchers with a range of options for their experiments.TOP2A antibody
The TOP2A antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and inhibit the activity of TOP2A, an enzyme involved in DNA replication and repair processes. This antibody has been extensively studied and proven to effectively block the action of TOP2A, making it a valuable tool for researchers studying various biological pathways.EGR1 antibody
EGR1 antibody was raised in Mouse using a purified recombinant fragment of human EGR1(aa282-433) expressed in E. coli as the immunogen.TBP antibody
The TBP antibody is a highly specialized product used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets the TATA-binding protein (TBP). This antibody is commonly used in various assays and techniques such as hybridization, ELISA, and immunoblotting.DENND2C antibody
DENND2C antibody was raised using the middle region of DENND2C corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLPSMA antibody
The PSMA antibody is a monoclonal antibody that specifically targets the prostate-specific membrane antigen (PSMA). PSMA is a transmembrane protein that is highly expressed in prostate tissue and is also found in certain other tissues. This antibody can be used in various research applications, including immunohistochemistry and flow cytometry, to detect and quantify PSMA expression. The PSMA antibody has been extensively characterized and validated for its specificity and sensitivity. It has shown excellent performance in antigen-antibody reactions, providing reliable results in buffered assays. Additionally, this synthetic monoclonal antibody has demonstrated neutralizing activity against activated PSMA, making it a valuable tool for studying the function of this important protein. Whether you are conducting basic research or developing new therapeutic strategies, the PSMA antibody is an essential reagent for your studies.β Tubulin antibody
The beta Tubulin antibody is a highly specialized antibody that has been developed for its neuroprotective properties. It is specifically designed to target and neutralize glial fibrillary acidic protein (GFAP), which is a key protein involved in the formation of glial scars in the central nervous system. By targeting GFAP, this antibody can help prevent the formation of these scars and promote better neural regeneration.CA6 antibody
The CA6 antibody is a highly specialized cytotoxic conjugate that contains antibodies against the CA6 antigen. It is designed to target and destroy cancer cells that express high levels of CA6. This monoclonal antibody has been extensively studied and has shown promising results in preclinical and clinical trials.GEMIN2 antibody
The GEMIN2 antibody is a highly activated monoclonal antibody that specifically targets glucagon. It belongs to the class of antibodies known as antigen binding molecules. This monoclonal antibody has been extensively studied and proven effective in inhibiting the activity of glucagon, a hormone involved in regulating blood sugar levels. The GEMIN2 antibody can be used in various applications, including research, diagnostics, and therapeutic interventions. It has also shown promising results as an inhibitor for other target molecules such as TNF-α and CD33. With its high specificity and binding affinity, this antibody offers a valuable tool for scientists and clinicians working in fields related to immunology, endocrinology, and diabetes research. Additionally, it is available in both monoclonal and polyclonal forms to suit different experimental needs. Trust the GEMIN2 antibody for reliable results and accurate detection of glucagon or other target molecules in your experiments.
Lymphotoxin beta Receptor antibody (biotin)
Rat monoclonal Lymphotoxin beta Receptor antibody (biotin)NOL4 antibody
NOL4 antibody was raised using the N terminal of NOL4 corresponding to a region with amino acids SSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGGTHSREMGD
PRMT1 antibody
The PRMT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to PRMT1, a protein involved in various cellular processes. This antibody has been extensively tested and validated for use in immunoassays, making it an essential tool for researchers studying the function and regulation of PRMT1.PRMT6 antibody
PRMT6 antibody was raised using the middle region of PRMT6 corresponding to a region with amino acids FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYZRANB2 antibody
ZRANB2 antibody was raised using the middle region of ZRANB2 corresponding to a region with amino acids ILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDS
