Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
IFNG antibody
IFNG antibody is a monoclonal antibody that specifically targets interferon-gamma (IFN-γ), a cytokine involved in immune responses. This antibody has the ability to neutralize the effects of IFN-γ by binding to it and preventing its interaction with target cells. It has been shown to have neuroprotective properties, protecting neurons from damage caused by various factors such as oxidative stress or inflammation. Additionally, IFNG antibody can be used in research and diagnostics in the life sciences field, particularly in studies involving collagen, human serum, or multidrug binding proteins. This antibody can also be immobilized on electrodes for use in immunoassays or other analytical techniques. Whether you need a high-quality product description for an eCommerce platform or engaging content for your website, I can help you create compelling copy that showcases the unique characteristics and benefits of your products. Let's work together to elevate your brand and drive sales!CD1D antibody
The CD1D antibody is a polyclonal antibody used in life sciences research. It targets CD1D, a protein involved in various cellular processes such as hepatocyte growth, chemokine production, and telomerase activity. This antibody has been shown to have cytotoxic effects on specific cell types and may be useful for studying thrombocytopenia and nephrotoxicity. Additionally, the CD1D antibody can be used to detect CXCR4 expression and inhibit its function. It belongs to the family of kinase inhibitors and is available as both colloidal and monoclonal antibodies. Researchers can rely on the high quality and specificity of this antibody for their experiments in various fields of study.AKAP5 antibody
AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEFeline Leukemia Virus p27 antibody (biotin)
Goat polyclonal Feline Leukemia Virus p27 antibody (biotin)UPB1 antibody
UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG
p70 S6 Kinase antibody
The p70 S6 Kinase antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This neutralizing antibody is specifically designed to target and inhibit the activity of p70 S6 Kinase, an important biomolecule involved in various cellular processes. By blocking the function of p70 S6 Kinase, this antibody can effectively modulate cell signaling pathways and regulate protein synthesis.Annexin A7 antibody
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGST Antibody
The GST Antibody is a highly specific and potent antibody that targets the cytosolic protein GST. It is designed to recognize and bind to the target molecule with high affinity, making it an ideal tool for various applications in Life Sciences research. The antibody is produced using advanced techniques, including DNA aptamer technology, resulting in a highly purified and effective product.KCNAB3 antibody
KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVNR2C2 antibody
NR2C2 antibody was raised using the C terminal of NR2C2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSCCR5 antibody
The CCR5 antibody is a highly effective polyclonal antibody that targets the CCR5 chemokine receptor. This receptor plays a crucial role in various immune responses and has been linked to several diseases, including HIV/AIDS. The CCR5 antibody works by binding to the receptor and blocking its activity, thereby inhibiting the entry of HIV into cells.NPY1R antibody
Rabbit polyclonal NPY1R antibody, detects endougenous levels, cross reactive mouse, rat
AURKA antibody
The AURKA antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers working with human serum and studying the effects of red ginseng on various cellular processes. This monoclonal antibody specifically targets and binds to AURKA, a protein that plays a crucial role in granulosa cell function.CTTN antibody
The CTTN antibody is a monoclonal antibody that specifically targets and binds to CTTN (Cortactin) protein. Cortactin is a regulator of actin cytoskeleton dynamics and plays a crucial role in cell migration, adhesion, and invasion. This antibody is widely used in life sciences research to study the function and localization of CTTN in various cellular processes.
RORA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
MUC1 antibody
The MUC1 antibody is a highly specialized monoclonal antibody that targets the glycoprotein MUC1. This glycoprotein plays a crucial role in cell signaling and immune response regulation. The MUC1 antibody specifically recognizes and binds to the glycan portion of MUC1, allowing for the detection and analysis of this protein in various biological samples.NKD1 antibody
NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGCD46 antibody
CD46 antibody is a monoclonal antibody that specifically targets CD46, a protein involved in immune regulation. This antibody has neutralizing properties and can inhibit the activity of CD46, thereby modulating immune responses. CD46 antibody is commonly used in research and diagnostic applications to study the role of CD46 in various biological processes. It can be used in combination with other antibodies or proteins, such as c-myc or streptavidin, to facilitate detection or functional studies. CD46 antibody is formulated with excipients to ensure stability and can be used in various experimental techniques, including immunohistochemistry, flow cytometry, and western blotting. Its application extends beyond basic research to fields like Life Sciences and medical research where it may have implications for conditions like leukemia and epidermal growth factor-related disorders.IL10 antibody
IL10 antibody was raised in mouse using highly pure recombinant human IL-10 as the immunogen.BTN1A1 antibody
The BTN1A1 antibody is a monoclonal antibody that specifically targets the BTN1A1 protein. It is commonly used in Life Sciences research and has a wide range of applications. This antibody can be used as an inhibitor to study the function of the BTN1A1 protein in various cellular processes. It is also widely used in immunoassays to detect and quantify the presence of BTN1A1 in samples such as human serum. The BTN1A1 antibody has shown cytotoxic activity against cells expressing high levels of BTN1A1, making it a potential therapeutic option for diseases associated with abnormal BTN1A1 expression. Additionally, this antibody can be used in combination with other monoclonal antibodies, such as anti-DNP antibodies or anti-HER2 antibodies, to enhance their efficacy and target specific signaling pathways involving growth factors like epidermal growth factor (EGF).PLAT antibody
PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRKCNG1 antibody
KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAChk2 antibody
The Chk2 antibody is a glycoprotein that belongs to the family of antibodies used in Life Sciences. It is specifically designed to target and bind to Chk2, a protein involved in cell cycle regulation and DNA damage response. This antibody can be used in various assays, such as immunohistochemistry and Western blotting, to study the expression and function of Chk2 in different biological samples. It is available both as a polyclonal antibody, which recognizes multiple epitopes on Chk2, and as a monoclonal antibody, which specifically binds to a single epitope. The Chk2 antibody can also be used as an inhibitor or neutralizing agent in experiments aiming to investigate the role of Chk2 in cellular processes. Its nuclear localization makes it an ideal tool for studying the subcellular distribution of Chk2 and its interactions with other proteins involved in DNA repair and cell cycle control.CTBP1 antibody
CTBP1 antibody was raised in mouse using recombinant human CTBP1 (1-440aa) purified from E. coli
Nucleophosmin antibody
The Nucleophosmin antibody is a highly effective and versatile tool for Life Sciences research. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. The Nucleophosmin antibody is designed to target and bind to nucleophosmin, a protein involved in various cellular processes such as ribosome biogenesis, DNA repair, and cell cycle regulation.TRKB antibody
The TRKB antibody is a polyclonal antibody used in life sciences research. It is specifically designed to target and bind to the TRKB receptor, which plays a crucial role in various cellular processes. This antibody can be used in experiments involving adipose tissue, as well as in studies investigating the effects of TNF-α (tumor necrosis factor-alpha) on cellular signaling pathways. The TRKB antibody can also be utilized for peptide nucleic acid (PNA) hybridization assays and is compatible with different detection methods such as immunohistochemistry or Western blotting. Whether you're studying binding proteins, natriuretic factors, or even botulinum toxin activity, the TRKB antibody provides reliable and accurate results. With its high specificity and affinity, this monoclonal antibody ensures precise targeting of the TRKB receptor in human serum samples or other biological specimens. Trust the TRKB antibody to deliver consistent and reproducible results for your research needs.PPP2R5C antibody
PPP2R5C antibody was raised using the middle region of PPP2R5C corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKMAPKAPK3 antibody
MAPKAPK3 antibody was raised in rabbit using the C terminal of MAPKAPK3 as the immunogenPALB2 antibody
The PALB2 antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in various biological processes, particularly in the regulation of actin filaments. This antibody specifically targets and activates actin, a protein essential for cell movement and structural support.SirT1 antibody
The SirT1 antibody is a highly specialized tool used in life sciences research. It is a polyclonal antibody that specifically targets the Sirtuin 1 (SirT1) protein, which plays a crucial role in various cellular processes. This antibody can be used in a wide range of applications, including western blotting, immunohistochemistry, and immunofluorescence.
Mucin-1 Antibody
The Mucin-1 Antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to Mucin-1, an important protein involved in various cellular processes. It has been extensively studied for its role in insulin signaling, c-myc activation, and nuclear localization.Epsin 1 antibody
Epsin 1 antibody was raised using the C terminal of EPN1 corresponding to a region with amino acids AATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGTau antibody
The Tau antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has the ability to neutralize interferon and collagen, making it an essential component in the field of Life Sciences. This antibody is available both as polyclonal antibodies derived from human serum and as monoclonal antibodies.
Nucleolin antibody
Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED
DLX5 antibody
The DLX5 antibody is a highly specialized and potent tool in the field of life sciences. It is a polyclonal antibody that specifically targets DLX5, a transcription factor involved in various cellular processes. This antibody can be used for research purposes, such as studying the role of DLX5 in development and disease progression.GREM2 antibody
GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKSRP68 antibody
SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRGChlamydia trachomatis antibody (biotin)
Chlamydia trachomatis antibody (biotin) was raised in rabbit using L2 and other serovar groups as the immunogen.IFITM3 antibody
The IFITM3 antibody is a polyclonal antibody that acts as an immunomodulatory agent. It specifically targets the glycoprotein IFITM3, which plays a crucial role in various biological processes. This antibody is widely used in the field of Life Sciences to study the function and regulation of IFITM3.Enolase 3 antibody
Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRPDXP antibody
PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
HIST1H1C antibody
HIST1H1C antibody was raised using the middle region of HIST1H1C corresponding to a region with amino acids ASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKS
ATF4 antibody
The ATF4 antibody is a polyclonal antibody that belongs to the group of antibodies used in Life Sciences research. It specifically targets ATF4, a transcription factor involved in cellular stress response and regulation of gene expression. This antibody can be used for various applications, such as Western blotting, immunohistochemistry, and immunofluorescence.
SORL1 antibody
SORL1 antibody was raised in Mouse using a purified recombinant fragment of SORL1(aa2159-2214) expressed in E. coli as the immunogen.C12ORF24 antibody
C12ORF24 antibody was raised using the N terminal Of C12Orf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQCD206 antibody
The CD206 antibody is a highly specialized antibody that belongs to the family of polyclonal antibodies. It is commonly used in life sciences research and has been proven to be effective in various applications. This antibody specifically targets the CD206 protein, which plays a crucial role in cell growth and development. The CD206 antibody has shown great potential as a growth factor, particularly in promoting the growth and proliferation of mesenchymal stem cells. Additionally, it has been found to have activated fatty acid metabolism and collagen synthesis pathways, making it an essential tool for studying these processes. Researchers have also discovered that the CD206 antibody can inhibit the activity of certain kinases, making it a valuable family kinase inhibitor. Whether you're studying chemokines or investigating epidermal growth factors, the CD206 antibody is an indispensable resource that will undoubtedly yield insightful results.Factor XI antibody
Factor XI antibody was raised in goat using human Factor XI purified from plasma as the immunogen.SYK antibody
SYK antibody was raised in Mouse using a purified recombinant fragment of SYK(aa296-484) expressed in E. coli as the immunogen.ICAM1 antibody
The ICAM1 antibody is a highly effective inhibitor that targets the vascular endothelial growth factor (VEGF) and other growth factors. It works by blocking the binding of these factors to their receptors, thereby preventing the activation of downstream signaling pathways. This antibody has been shown to inhibit the production of superoxide, a reactive oxygen species that plays a key role in inflammation and oxidative stress. Additionally, it inhibits protein kinase activity, which is involved in various cellular processes such as cell proliferation and survival. The ICAM1 antibody is a polyclonal antibody that has been extensively tested and validated for use in research studies in the field of life sciences. It can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody specifically binds to ICAM1, a cell surface glycoprotein that is involved in cell adhesion and immune response regulation. Its binding properties have been optimized to ensure high specificity and sensitivity. The ICAM1 antibody is anMAP2K4 antibody
MAP2K4 antibody was raised in Mouse using a purified recombinant fragment of MAP2K4 expressed in E. coli as the immunogen.TEX9 antibody
TEX9 antibody was raised using the middle region of TEX9 corresponding to a region with amino acids QAASSQSATEVRLNRALEEAEKYKLELSKLRQNNKDIANEEHKKIEVLKSPLXDC1 antibody
The PLXDC1 antibody is a monoclonal antibody that specifically targets the PLXDC1 protein. This protein is involved in various cellular processes, including platelet fibrinogen binding and arginase activity. The PLXDC1 antibody can be used in research and diagnostics to study the expression and function of PLXDC1.CDH5 antibody
The CDH5 antibody is a highly specialized antibody that targets the CDH5 protein. This protein is involved in various cellular processes, including cell adhesion and growth factor signaling. The CDH5 antibody can be used to detect the presence of CDH5 in nuclear extracts, making it a valuable tool for research in the field of molecular biology.GRIPAP1 antibody
GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEVPPM1B antibody
The PPM1B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the circumsporozoite protein, an antigen involved in endothelial growth and development. By binding to this protein, the PPM1B antibody can inhibit the activity of growth factors such as collagen, fibronectin, and VEGF-C. This antibody is commonly used in immunohistochemistry studies to visualize and analyze the expression of endothelial growth factors in various tissues. Its high specificity and affinity make it a valuable tool for researchers studying angiogenesis and other processes related to endothelial growth.CATSPER2 antibody
CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDKLOX antibody
The LOX antibody is a glycoprotein that is found in human serum and has been shown to have various functions. It plays a role in regulating the activity of mesenchymal stem cells and can interact with fibrinogen. The LOX antibody is a monoclonal antibody that is capable of neutralizing the effects of LOX. Monoclonal antibodies are highly specific and can be used for various applications in the field of Life Sciences. The LOX antibody can be produced using an expression plasmid and can be immobilized on a carbon electrode for use in electrochemical assays. This antibody has potential applications in research, diagnostics, and therapeutics, particularly in the study of chemokines and their role in various diseases.UBE3A antibody
The UBE3A antibody is a powerful tool in the field of biomedical research. It belongs to the class of polyclonal antibodies and is commonly used as an inhibitor for various proteins and hormones, including VEGF (vascular endothelial growth factor) and natriuretic peptides. This antibody can be used in both in vitro and in vivo studies to investigate the role of specific proteins in different biological processes.GNGT2 antibody
GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLISHEXIM2 antibody
HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESPAK2 antibody
PAK2 antibody was raised in Mouse using a purified recombinant fragment of PAK2 expressed in E. coli as the immunogen.Adiponectin antibody
The Adiponectin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets adiponectin, a hormone involved in various physiological processes such as metabolism and inflammation. This antibody has been extensively studied for its role in regulating epidermal growth factor (EGF) signaling, human chorionic gonadotropin (hCG) production, and anti-vascular endothelial growth factor (anti-VEGF) therapy.Cyclin G1 antibody
The Cyclin G1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes Cyclin G1, a growth factor involved in various cellular processes. This antibody has been extensively studied and shown to have high specificity and affinity for its target.NXF1 antibody
NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSPGLS antibody
PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTLARAF antibody
The ARAF antibody is a protein-coupled antibody that specifically targets ARAF, a member of the RAF family of serine/threonine kinases. This antibody is commonly used in research and diagnostic assays to detect and quantify ARAF expression levels in various tissues and cell types. It has been extensively validated for its specificity and sensitivity, making it a reliable tool for studying signal transduction pathways involving ARAF. Additionally, this antibody has shown potential therapeutic applications in the field of regenerative medicine, particularly in the development of treatments for disorders related to pluripotent stem cells and fetal hemoglobin. With its high affinity and excellent performance in different experimental settings, the ARAF antibody is an essential component for life sciences research and drug discovery.Progesterone Receptor Antibody
The Progesterone Receptor Antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the progesterone receptor, a protein involved in various biological processes such as cell growth and differentiation. This antibody can be used to study the role of progesterone and its receptor in different tissues and cell types.FGFR4 antibody
FGFR4 antibody was raised in Mouse using purified recombinant extracellular fragment of human FGFR4 fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.SmG antibody
The SmG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the Sm protein, which plays a crucial role in RNA processing and splicing. This antibody has been extensively tested and validated for use in various assays, including Western blotting, immunohistochemistry, and immunofluorescence. The SmG antibody can be used to study the expression and localization of the Sm protein in different cell types and tissues. It has also been shown to have cyclase-activating properties, leading to increased intracellular levels of cyclic AMP (cAMP). This antibody is an essential tool for researchers studying RNA processing, gene expression regulation, and cellular signaling pathways.HNRPA3 antibody
HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSSFRP2 antibody
The SFRP2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the SFRP2 protein, which plays a crucial role in various biological processes. This antibody can be used for research purposes to study the function and regulation of SFRP2 in different cellular contexts.
WDR49 antibody
WDR49 antibody was raised using the C terminal of WDR49 corresponding to a region with amino acids ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAPBX1 antibody
The PBX1 antibody is a biomarker that is commonly used in immunohistochemical studies. It specifically targets the PBX1 protein, which plays a crucial role in hematopoietic development and stem cell maintenance. By using this antibody, researchers can identify and study the expression of PBX1 in various tissues and cell types.ICAM1 antibody
The ICAM1 antibody is a diagnostic reagent used in various applications. It is an antibody that specifically binds to ICAM1, which stands for intercellular adhesion molecule 1. ICAM1 is a protein found on the surface of cells, particularly respiratory epithelial cells. This antibody can be used for receptor binding studies, as it has a high affinity for ICAM1 and can help detect its presence in samples.OMA1 antibody
The OMA1 antibody is a serum marker that is widely used in biochemical research. It is an antibody that specifically targets the transmembrane conductance regulator (CFTR), which plays a crucial role in ion transport across cell membranes. This antibody can be used as a tool to study CFTR function and regulation in various experimental systems, including pluripotent stem cells. Additionally, the OMA1 antibody has been shown to have therapeutic potential as it can act as an active agent against certain diseases associated with CFTR dysfunction. It has also been found to be effective in targeting interferon-stimulated genes and inhibiting their expression, making it valuable in interferon-related research. Furthermore, this antibody has been extensively studied in the field of autoantibodies and has shown promising results for the development of new diagnostic and therapeutic approaches for autoimmune diseases. In summary, the OMA1 antibody is a versatile tool that has significant implications in life sciences research and holds great promise for the development of new medicinesPOLDIP3 antibody
The POLDIP3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the virus surface antigen and has cytotoxic effects on infected cells. This antibody is activated upon binding to its target, leading to the inhibition of histidine growth factor family kinases. By blocking these kinases, the POLDIP3 antibody prevents cell proliferation and promotes apoptosis.Parathyroid Hormone Antibody
The Parathyroid Hormone Antibody is an elastomeric protein complex that can be used as a medicament for various applications. It can be measured using fluorescence or chemiluminescence methods with the help of specialized electrodes. This antibody is produced using monoclonal antibody technology and has a high affinity for binding proteins such as growth factors and guanidine. It can also be used to detect and neutralize clostridial neurotoxins. With its immobilization properties, this antibody offers great potential in research and diagnostic applications.MSI1 antibody
The MSI1 antibody is a monoclonal antibody that targets the MSI1 protein, which plays a crucial role in various cellular processes. It acts as a cation and octanoyltransferase, as well as a methyl transferase. The MSI1 antibody is widely used in the field of life sciences for research purposes, particularly in studying the biomarker composition of different diseases and conditions. It has been shown to be effective in detecting and quantifying the levels of MSI1 protein, making it a valuable tool for researchers working with antibodies and interleukins. Additionally, the MSI1 antibody can be utilized as an inhibitor to study its impact on specific cellular pathways. Its high specificity and affinity make it an ideal choice for those looking to explore the functions and mechanisms of MSI1 in various biological systems.Glucagon antibody
The Glucagon antibody is a highly specialized product that targets pancreatic glucagon, a hormone involved in regulating blood sugar levels. This antibody has been developed to specifically bind to and neutralize glucagon, making it an effective tool for research and therapeutic applications.POLI antibody
POLI antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDGranzyme B antibody
The Granzyme B antibody is a highly specialized antibody that plays a crucial role in the immune response. It is a polyclonal antibody that specifically targets non-phosphorylated nuclear proteins. This antibody is used to detect and study syncytia formation, which is the fusion of multiple cells into a single multinucleated cell. Additionally, it can be used as a monoclonal antibody to target specific lysine residues on proteins.GOLM1 antibody
The GOLM1 antibody is a specific antibody that targets the Golgi membrane protein 1 (GOLM1). It is a monoclonal antibody that has been developed to detect and bind to GOLM1, which is involved in various cellular processes. This antibody can be used for research purposes, such as studying the function of GOLM1 in different cell types or investigating its role in disease development. The GOLM1 antibody has also shown potential as a serum marker for certain conditions, making it a valuable tool for diagnostic applications. With its high specificity and sensitivity, this antibody offers researchers and clinicians a reliable means of studying and detecting GOLM1 in various biological samples.
