Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ATP11B antibody
ATP11B antibody was raised using the N terminal of ATP11B corresponding to a region with amino acids DIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGETNLKTHVAVPETAPurity:Min. 95%Ephrin-B1 antibody
Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGPurity:Min. 95%FAM20A antibody
FAM20A antibody was raised using the N terminal of FAM20A corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF
Purity:Min. 95%JMJD2C antibody
JMJD2C antibody was raised in rabbit using the middle region of JMJD2C as the immunogenPurity:Min. 95%SAC antibody
SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKELPurity:Min. 95%PYY antibody
PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED
Purity:Min. 95%ZNF258 antibody
ZNF258 antibody was raised in rabbit using the middle region of ZNF258 as the immunogenPurity:Min. 95%BTBD15 antibody
BTBD15 antibody was raised in rabbit using the C terminal of BTBD15 as the immunogen
Purity:Min. 95%SREBF1 antibody
SREBF1 antibody was raised in rabbit using the N terminal of SREBF1 as the immunogenPurity:Min. 95%PARK7 antibody
PARK7 antibody was raised in rabbit using residues 167-189 (AIVEALNGKEVAAQVKAPLVLKD) of human PARK7 (DJ-1) as the immunogen.Purity:Min. 95%RELM alpha antibody
RELM alpha antibody was raised in rabbit using residues 31-44 of the mouse RELMalpha protein as the immunogen.Purity:Min. 95%ZBTB33 antibody
ZBTB33 antibody was raised in rabbit using the N terminal of ZBTB33 as the immunogenPurity:Min. 95%RPA1 antibody
RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAPurity:Min. 95%PER2 antibody
PER2 antibody was raised in rabbit using the middle region of PER2 as the immunogenPurity:Min. 95%PARL antibody
PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQPurity:Min. 95%MYBPH antibody
MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPPurity:Min. 95%ABCF2 antibody
ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELPurity:Min. 95%RHOT1 antibody
RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERPurity:Min. 95%Psenen antibody
Psenen antibody was raised in rabbit using the N terminal of Psenen as the immunogenPurity:Min. 95%ASCL4 antibody
ASCL4 antibody was raised in rabbit using the N terminal of ASCL4 as the immunogenPurity:Min. 95%DUSP12 antibody
DUSP12 antibody was raised in rabbit using the N terminal of DUSP12 as the immunogenPurity:Min. 95%TMCC1 antibody
TMCC1 antibody was raised using the C terminal of TMCC1 corresponding to a region with amino acids ERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEACPurity:Min. 95%IL10 antibody
IL10 antibody was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.Purity:Min. 95%KIF2A antibody
KIF2A antibody was raised using the N terminal of KIF2A corresponding to a region with amino acids IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSPurity:Min. 95%SLC25A35 antibody
SLC25A35 antibody was raised using the N terminal of SLC25A35 corresponding to a region with amino acids DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFIPurity:Min. 95%ZNF138 antibody
ZNF138 antibody was raised in rabbit using the middle region of ZNF138 as the immunogenPurity:Min. 95%Cytokeratin 18 antibody
The Cytokeratin 18 antibody is a highly activated monoclonal antibody that specifically targets cytokeratin 18, a protein found in human serum. This antibody is cationic in nature and has been extensively studied for its ability to bind to cytokeratin 18 and induce cytotoxic effects. It has been used in various research applications, including immunohistochemistry and western blotting, to detect the presence of cytokeratin 18 in different tissues and cell types.Purity:Min. 95%EHMT2 antibody
EHMT2 antibody was raised in rabbit using the N terminal of EHMT2 as the immunogen
Purity:Min. 95%CFTR antibody
CFTR antibody was raised in rabbit using a synthetic peptide, G(103) R I I A S Y D P D N K E E R(117), as the immunogen.Purity:Min. 95%PSMD1 antibody
PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEPurity:Min. 95%Goat anti Rabbit IgG Fc
Goat anti-rabbit IgG Fc was raised in goat using rabbit igG, Fc fragment as the immunogen.Purity:Min. 95%SYT3 antibody
SYT3 antibody was raised using the N terminal of SYT3 corresponding to a region with amino acids VSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGG
Purity:Min. 95%LARGE antibody
LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE
Purity:Min. 95%SpUlp2 antibody
SpUlp2 antibody was raised in rabbit using residues 622-635 [SNNERQSLSSGSND] of the SpUlp2 protein as the immunogen.Purity:Min. 95%Pigs antibody
Pigs antibody was raised in rabbit using the C terminal of Pigs as the immunogenPurity:Min. 95%SLC34A3 antibody
SLC34A3 antibody was raised in rabbit using the middle region of SLC34A3 as the immunogen
Purity:Min. 95%Glycoprotein antibody
Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVPurity:Min. 95%NRP1 antibody
NRP1 antibody was raised in rabbit using the N terminal of NRP1 as the immunogen
Purity:Min. 95%KLF14 antibody
KLF14 antibody was raised in rabbit using the N terminal of KLF14 as the immunogen
Purity:Min. 95%SPINT1 antibody
SPINT1 antibody was raised in rabbit using the C terminal of SPINT1 as the immunogenPurity:Min. 95%DMBX1 antibody
DMBX1 antibody was raised in rabbit using the middle region of DMBX1 as the immunogen
Purity:Min. 95%ZNF619 antibody
ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogenPurity:Min. 95%TEX264 antibody
TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPurity:Min. 95%IGF BP7 antibody
IGF BP7 antibody was raised in rabbit using highly pure recombinant human IGF-BP7 as the immunogen.
Purity:Min. 95%FOXN4 antibody
FOXN4 antibody was raised in rabbit using the C terminal of FOXN4 as the immunogen
Purity:Min. 95%CYP4X1 antibody
CYP4X1 antibody was raised using the middle region of CYP4X1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPPurity:Min. 95%Claudin 19 antibody
Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGVPurity:Min. 95%ZNFN1A5 antibody
ZNFN1A5 antibody was raised in rabbit using the N terminal of ZNFN1A5 as the immunogenPurity:Min. 95%PTCH2 antibody
PTCH2 antibody was raised in rabbit using residues 226-235 [GPFASLEGFR] of the human PTCH2 protein as the immunogen.Purity:Min. 95%CDH1 antibody
CDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDPurity:Min. 95%Abca1 antibody
Abca1 antibody was raised in rabbit using the middle region of Abca1 as the immunogenPurity:Min. 95%IKZF3 antibody
IKZF3 antibody was raised in rabbit using the C terminal of IKZF3 as the immunogenPurity:Min. 95%Mbtd1 antibody
Mbtd1 antibody was raised in rabbit using the middle region of Mbtd1 as the immunogen
Purity:Min. 95%FGF17 antibody
FGF17 antibody was raised in goat using highly pure recombinant human FGF-17 as the immunogen.
Purity:Min. 95%ARHGAP20 antibody
ARHGAP20 antibody was raised in rabbit using the middle region of ARHGAP20 as the immunogenPurity:Min. 95%SLC10A7 antibody
SLC10A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTPPurity:Min. 95%CACNB2 antibody
CACNB2 antibody was raised in rabbit using the C terminal of CACNB2 as the immunogenPurity:Min. 95%PHF2 antibody
PHF2 antibody was raised in rabbit using residues 70-82 [KHGPGPTPDVKRVC] of the 120 kDa PHF protein as the immunogen.
Purity:Min. 95%PYGO2 antibody
PYGO2 antibody was raised in rabbit using the N terminal of PYGO2 as the immunogen
Purity:Min. 95%ZNF783 antibody
ZNF783 antibody was raised in rabbit using the middle region of ZNF783 as the immunogen
Purity:Min. 95%ARC antibody
ARC antibody was raised in rabbit using the N terminal of ARC as the immunogenPurity:Min. 95%KIAA1618 antibody
KIAA1618 antibody was raised in rabbit using the N terminal of KIAA1618 as the immunogenPurity:Min. 95%GPR177 antibody
GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEPurity:Min. 95%C21ORF62 antibody
C21ORF62 antibody was raised using the middle region of C21Orf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL
Purity:Min. 95%HSD3B2 antibody
HSD3B2 antibody was raised using the N terminal of HSD3B2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNPurity:Min. 95%ALDH3A2 antibody
ALDH3A2 antibody was raised using the C terminal of ALDH3A2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGPurity:Min. 95%FLJ30934 antibody
FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogenPurity:Min. 95%GABRB2 antibody
GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWPurity:Min. 95%HKR1 antibody
HKR1 antibody was raised in rabbit using the N terminal of HKR1 as the immunogenPurity:Min. 95%SPIC antibody
SPIC antibody was raised in rabbit using the middle region of SPIC as the immunogenPurity:Min. 95%FBXL11 antibody
FBXL11 antibody was raised in rabbit using the N terminal of FBXL11 as the immunogenPurity:Min. 95%Collagen Type V antibody
Collagen type V antibody was raised in rabbit using collagen type V from human and bovine placenta as the immunogen.Purity:Min. 95%KLHDC3 antibody
KLHDC3 antibody was raised in rabbit using the N terminal of KLHDC3 as the immunogen
Purity:Min. 95%ZNF228 antibody
ZNF228 antibody was raised in rabbit using the N terminal of ZNF228 as the immunogen
Purity:Min. 95%PIGQ antibody
PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQSPurity:Min. 95%MSH4 antibody
MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSVPurity:Min. 95%LBX2 antibody
LBX2 antibody was raised in rabbit using the middle region of LBX2 as the immunogenPurity:Min. 95%ZNF131 antibody
ZNF131 antibody was raised in rabbit using the N terminal of ZNF131 as the immunogenPurity:Min. 95%TYK2 antibody
TYK2 antibody was raised in rabbit using the C terminal of TYK2 as the immunogen
Purity:Min. 95%SLC6A15 antibody
SLC6A15 antibody was raised using the N terminal of SLC6A15 corresponding to a region with amino acids DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMTPurity:Min. 95%TUJ1 antibody
TUJ1 antibody was raised in rabbit using residues 433-450 EGEMYEDDEEESEAQGPK of the 50 kDa human beta-tubulin-III protein as the immunogen.Purity:Min. 95%IMPAD1 antibody
IMPAD1 antibody was raised using the middle region of IMPAD1 corresponding to a region with amino acids TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPurity:Min. 95%UGT2B15 antibody
UGT2B15 antibody was raised using the N terminal of UGT2B15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYPurity:Min. 95%PAFAH1B1 antibody
PAFAH1B1 antibody was raised using the N terminal of PAFAH1B1 corresponding to a region with amino acids KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFPurity:Min. 95%SSR1 antibody
SSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIPurity:Min. 95%ELMO3 antibody
ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSREDPurity:Min. 95%GPS1 antibody
GPS1 antibody was raised in rabbit using the N terminal of GPS1 as the immunogen
Purity:Min. 95%CNDP2 antibody
CNDP2 antibody was raised in rabbit using the middle region of CNDP2 as the immunogenPurity:Min. 95%Neuroplastin antibody
Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKPurity:Min. 95%IL1RA antibody
IL1RA antibody was raised in rabbit using highly pure recombinant human IL-1RA as the immunogen.Purity:Min. 95%PITX1 antibody
PITX1 antibody was raised in rabbit using the middle region of PITX1 as the immunogenPurity:Min. 95%COLEC12 antibody
COLEC12 antibody was raised using the middle region of COLEC12 corresponding to a region with amino acids AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGPSGDPGPPGPurity:Min. 95%Leptin antibody
Leptin antibody was raised using the middle region of LEP corresponding to a region with amino acids LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMPurity:Min. 95%FCN1 antibody
FCN1 antibody was raised in rabbit using the middle region of FCN1 as the immunogen
Purity:Min. 95%C4orf19 antibody
C4orf19 antibody was raised in rabbit using the N terminal of C4orf19 as the immunogenPurity:Min. 95%TBC1D19 antibody
TBC1D19 antibody was raised in rabbit using the middle region of TBC1D19 as the immunogenPurity:Min. 95%GPAA1 antibody
GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGLPurity:Min. 95%Adam23 antibody
Adam23 antibody was raised in rabbit using the C terminal of Adam23 as the immunogenPurity:Min. 95%CDK5RAP1 antibody
CDK5RAP1 antibody was raised using the N terminal of CDK5RAP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVIPurity:Min. 95%FES antibody
FES antibody was raised using the N terminal of FES corresponding to a region with amino acids ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL
Purity:Min. 95%MPPED2 antibody
MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT
Purity:Min. 95%TMEM127 antibody
TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
Purity:Min. 95%CLACP antibody
CLACP antibody was raised in rabbit using residues 430-443 [DYNGNLHEALQRIT] of the NC3 region of human and mouse CLAC-P as the immunogen.
Purity:Min. 95%ZNF177 antibody
ZNF177 antibody was raised in rabbit using the middle region of ZNF177 as the immunogenPurity:Min. 95%SERPINC1 antibody
SERPINC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDPurity:Min. 95%BSA antibody
The BSA antibody is a highly specialized antibody that is used in various assays and research applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering different advantages depending on the specific needs of the experiment.Purity:Min. 95%FMO5 antibody
FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGNPurity:Min. 95%UGCGL2 antibody
UGCGL2 antibody was raised using the middle region of UGCGL2 corresponding to a region with amino acids LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDELPurity:Min. 95%PYHIN1 antibody
PYHIN1 antibody was raised in rabbit using the N terminal of PYHIN1 as the immunogenPurity:Min. 95%MC1R antibody
MC1R antibody was raised in rabbit using a 21 amino acid peptide of mouse MC1-R as the immunogen.Purity:Min. 95%ZNF317 antibody
ZNF317 antibody was raised in rabbit using the C terminal of ZNF317 as the immunogenPurity:Min. 95%ZNF385 antibody
ZNF385 antibody was raised in rabbit using the C terminal of ZNF385 as the immunogenPurity:Min. 95%DNAJC2 antibody
DNAJC2 antibody was raised in rabbit using the C terminal of DNAJC2 as the immunogenPurity:Min. 95%LOC729745 antibody
LOC729745 antibody was raised in rabbit using the N terminal of LOC729745 as the immunogenPurity:Min. 95%LGALS1 antibody
LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
Purity:Min. 95%FLJ20489 antibody
FLJ20489 antibody was raised using the C terminal of FLJ20489 corresponding to a region with amino acids LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKVPurity:Min. 95%CSRP2 antibody
CSRP2 antibody was raised in rabbit using the C terminal of CSRP2 as the immunogenPurity:Min. 95%SLC15A4 antibody
SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
Purity:Min. 95%TAF13 antibody
TAF13 antibody was raised in rabbit using the N terminal of TAF13 as the immunogenPurity:Min. 95%PRKCB1 antibody
PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSPurity:Min. 95%PRRG1 antibody
PRRG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREA
Purity:Min. 95%GLMN antibody
GLMN antibody was raised using the N terminal of GLMN corresponding to a region with amino acids AVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNPurity:Min. 95%Histone H4 antibody
The Histone H4 antibody is a growth factor biomolecule that plays a crucial role in various biological processes. This antibody, also known as trastuzumab, is designed to specifically target and bind to histone H4, a protein involved in chromatin structure and gene regulation. By binding to histone H4, this antibody can modulate gene expression and cellular functions.Purity:Min. 95%SUZ12 antibody
SUZ12 antibody was raised in rabbit using the C terminal of SUZ12 as the immunogenPurity:Min. 95%Pa2g4 antibody
Pa2g4 antibody was raised in rabbit using the C terminal of Pa2g4 as the immunogenPurity:Min. 95%MAPK3 antibody
MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDPurity:Min. 95%BUB3 antibody
BUB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRPurity:Min. 95%MSH5 antibody
MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLIPurity:Min. 95%DEDD2 antibody
DEDD2 antibody was raised in rabbit using the middle region of DEDD2 as the immunogen
Purity:Min. 95%ZNF662 antibody
ZNF662 antibody was raised in rabbit using the middle region of ZNF662 as the immunogenPurity:Min. 95%COPA antibody
COPA antibody was raised using the middle region of COPA corresponding to a region with amino acids IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEITPurity:Min. 95%Tau antibody
The Tau antibody is a highly specialized antibody that targets and interacts with the protein tau. Tau is involved in various cellular processes, including the stabilization of microtubules. This antibody has been extensively studied for its potential role in neurodegenerative diseases like Alzheimer's disease.Purity:Min. 95%Arsb antibody
Arsb antibody was raised in rabbit using the middle region of Arsb as the immunogen
Purity:Min. 95%IL22 antibody
IL22 antibody was raised in rabbit using highly pure recombinant human IL-22 as the immunogen.Purity:Min. 95%DAGLB antibody
DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGSPurity:Min. 95%TLE2 antibody
TLE2 antibody was raised in rabbit using the N terminal of TLE2 as the immunogen
Purity:Min. 95%Onecut 1 antibody
Onecut 1 antibody was raised in rabbit using the C terminal of Onecut 1 as the immunogenPurity:Min. 95%SLC1A2 antibody
SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKPurity:Min. 95%LRRTM1 antibody
LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHPurity:Min. 95%NFAT5 antibody
NFAT5 antibody was raised in rabbit using the middle region of NFAT5 as the immunogenPurity:Min. 95%Man2a2 antibody
Man2a2 antibody was raised in rabbit using the N terminal of Man2a2 as the immunogenPurity:Min. 95%MAP3K7IP1 antibody
MAP3K7IP1 antibody was raised using the N terminal of MAP3K7IP1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEPurity:Min. 95%SLC38A3 antibody
SLC38A3 antibody was raised using the N terminal of SLC38A3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMPurity:Min. 95%FGF basic antibody
FGF basic antibody was raised in rabbit using highly pure recombinant human FGF-basic as the immunogen.Purity:Min. 95%ATP2A1 antibody
ATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWPcdh11x antibody
Pcdh11x antibody was raised in rabbit using the middle region of Pcdh11x as the immunogen
Purity:Min. 95%Dhrs7 antibody
Dhrs7 antibody was raised in rabbit using the N terminal of Dhrs7 as the immunogen
Purity:Min. 95%Vps72 antibody
Vps72 antibody was raised in rabbit using the N terminal of Vps72 as the immunogenPurity:Min. 95%ZFP90 antibody
ZFP90 antibody was raised in rabbit using the middle region of ZFP90 as the immunogen
Purity:Min. 95%ADSL antibody
ADSL antibody was raised in rabbit using the middle region of ADSL as the immunogen
Purity:Min. 95%DPF1 antibody
DPF1 antibody was raised in rabbit using the middle region of DPF1 as the immunogenPurity:Min. 95%Matrilin 3 antibody
Matrilin 3 antibody was raised using the N terminal of MATN3 corresponding to a region with amino acids ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTPurity:Min. 95%NT3 antibody
NT3 antibody was raised in rabbit using highly pure recombinant human NT-3 as the immunogen.Purity:Min. 95%IFIT5 antibody
IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEPurity:Min. 95%CYP3A5 antibody
CYP3A5 antibody was raised in rabbit using the N terminal of CYP3A5 as the immunogenPurity:Min. 95%ADAM2 antibody
ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVILPurity:Min. 95%Tmco3 antibody
Tmco3 antibody was raised in rabbit using the middle region of Tmco3 as the immunogenPurity:Min. 95%LRRN2 antibody
LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSPurity:Min. 95%MYOZ1 antibody
MYOZ1 antibody was raised in rabbit using the N terminal of MYOZ1 as the immunogenPurity:Min. 95%CLACP antibody
CLACP antibody was raised in rabbit using residues 171-183 [NHGFLSADQQLIK] of the NC2-1 region of human and mouse CLAC-P as the immunogen.Purity:Min. 95%CKAP4 antibody
CKAP4 antibody was raised using the middle region of CKAP4 corresponding to a region with amino acids LRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKVPurity:Min. 95%UGT8 antibody
UGT8 antibody was raised using the middle region of UGT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTIPurity:Min. 95%XRCC2 antibody
XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFAPurity:Min. 95%RNASE11 antibody
RNASE11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWLPurity:Min. 95%SERPINA5 antibody
SERPINA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSAPurity:Min. 95%TRAPPC5 antibody
TRAPPC5 antibody was raised in rabbit using the N terminal of TRAPPC5 as the immunogenPurity:Min. 95%PON3 antibody
PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYPurity:Min. 95%LOC732440 antibody
LOC732440 antibody was raised in rabbit using the C terminal of LOC732440 as the immunogenPurity:Min. 95%Carboxypeptidase B1 antibody
Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLPurity:Min. 95%DLL4 antibody
DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF
Purity:Min. 95%VEGF antibody
VEGF antibody was raised in goat using highly pure recombinant human VEGF as the immunogen.Purity:Min. 95%ZNF200 antibody
ZNF200 antibody was raised in rabbit using the middle region of ZNF200 as the immunogenPurity:Min. 95%EGLN2 antibody
EGLN2 antibody was raised in rabbit using the C terminal of Egln2 as the immunogen
Purity:Min. 95%PIK3IP1 antibody
PIK3IP1 antibody was raised using the middle region of PIK3IP1 corresponding to a region with amino acids QALPAFTTEIQEASEGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVPurity:Min. 95%IFIT2 antibody
IFIT2 antibody was raised using the N terminal of IFIT2 corresponding to a region with amino acids SENNKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKAPurity:Min. 95%RAD54B antibody
RAD54B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGTPurity:Min. 95%KIF23 antibody
KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQPurity:Min. 95%FEM1B antibody
FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVREPurity:Min. 95%NPFFR2 antibody
NPFFR2 antibody was raised in rabbit using the C terminal of NPFFR2 as the immunogenPurity:Min. 95%HAMP antibody
HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPurity:Min. 95%ZNF766 antibody
ZNF766 antibody was raised in rabbit using the N terminal of ZNF766 as the immunogenPurity:Min. 95%KCNK4 antibody
KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAPurity:Min. 95%FMNL2 antibody
FMNL2 antibody was raised in rabbit using the N terminal of FMNL2 as the immunogenPurity:Min. 95%Transglutaminase 2 antibody
Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGPurity:Min. 95%Abcb10 antibody
Abcb10 antibody was raised in rabbit using the middle region of Abcb10 as the immunogenPurity:Min. 95%ZNF174 antibody
ZNF174 antibody was raised in rabbit using the middle region of ZNF174 as the immunogenPurity:Min. 95%Cacng8 antibody
Cacng8 antibody was raised in rabbit using the middle region of Cacng8 as the immunogenPurity:Min. 95%MPL antibody
The MPL antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets the myeloproliferative leukemia (MPL) receptor, which is a tyrosine kinase receptor involved in the regulation of hematopoiesis. This antibody has been extensively studied and has shown neutralizing activity against MPL ligands such as thrombopoietin, resulting in the inhibition of downstream signaling pathways.Purity:Min. 95%SMYD4 antibody
SMYD4 antibody was raised in rabbit using the N terminal of SMYD4 as the immunogenPurity:Min. 95%TIMP2 antibody
TIMP2 antibody was raised in rabbit using the N terminal of TIMP2 as the immunogen
Purity:Min. 95%GRAMD2 antibody
GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFPurity:Min. 95%
