Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SPRR3 antibody
SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids PTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKGSTP1 antibody
The GSTP1 antibody is a monoclonal antibody that specifically targets the glutathione S-transferase P1 (GSTP1) protein. This protein plays a crucial role in cellular detoxification processes and is involved in the metabolism of various drugs and toxins. The GSTP1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in several areas.
C10ORF132 antibody
C10ORF132 antibody was raised using the N terminal Of C10Orf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQIL9 antibody
IL9 antibody was raised in rabbit using highly pure recombinant murine IL-9 as the immunogen.alpha 1 Antiplasmin antibody (HRP)
alpha 1 Antiplasmin antibody (HRP) was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.TCP11L2 antibody
TCP11L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQICDCUN1D4 antibody
DCUN1D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL
AP1M2 antibody
AP1M2 antibody was raised using the N terminal of AP1M2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLTNFRSF1A antibody
TNFRSF1A antibody was raised in rabbit using the N terminal of TNFRSF1A as the immunogenEGFR antibody
EGFR antibody was raised in mouse using recombinant human EGFR (424-605aa) purified from E. coli as the immunogen.
TPRKB antibody
TPRKB antibody was raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSCASP8 antibody
The CASP8 antibody is a highly specialized polyclonal antibody that has been biotinylated for enhanced detection capabilities. It specifically targets the elastase protein and bovine γ-globulin, making it an essential tool in various research applications within the Life Sciences field. The CASP8 antibody is also available in monoclonal form, providing consistent and reliable results.
NR2F1 antibody
NR2F1 antibody was raised using the N terminal of NR2F1 corresponding to a region with amino acids GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVTSH (intact) antibody
TSH (intact) antibody was raised against Human Thryoid Stimulating Hormone (TSH, intact).PI4K2B antibody
PI4K2B antibody was raised using the middle region of PI4K2B corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGAIARS antibody
IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFGPPP1R11 antibody
PPP1R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN
PIK3R5 antibody
PIK3R5 antibody was raised using the N terminal of PIK3R5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSMDM2 antibody
The MDM2 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. This antibody can be used to study the function of MDM2 in various cellular processes.RBM11 antibody
RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRRat Myeloid Precursor Cells antibody
Rat myeloid precursor cells antibody was raised in rat using mouse macrophage precursor cells as the immunogen.CYSLTR2 antibody
The CYSLTR2 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor. It is specifically designed to neutralize the effects of this growth factor and has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting the activity of epidermal growth factor and Angptl3, which are known to play a crucial role in various cellular processes. The CYSLTR2 antibody is available as both polyclonal antibodies and low-molecular-weight dimers, making it suitable for a wide range of applications. Its high affinity for its target makes it an ideal tool for immunoassays and chromatographic techniques. With its exceptional specificity and neutralizing capabilities, the CYSLTR2 antibody is an invaluable asset for researchers in the field of Life Sciences.PSMD3 antibody
PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASPaxillin antibody
The Paxillin antibody is a highly specialized monoclonal antibody that targets the activated form of paxillin, an inhibitory factor involved in cell signaling pathways. This antibody has been extensively tested and shown to effectively neutralize the activity of paxillin, making it a valuable tool for researchers studying cell growth and development. Additionally, this antibody has been found to have high substrate specificity, meaning it only binds to the activated form of paxillin and not other related proteins. This specificity ensures accurate and reliable results in experiments involving paxillin signaling. The Paxillin antibody is also available as polyclonal antibodies for use in a wider range of applications. These antibodies have been validated for use in primary cells and are widely used in life sciences research. Whether you're studying interferon signaling, interleukin-6 regulation, or leukemia inhibitory factor activity, the Paxillin antibody is an essential tool for your research needs.EIF3EIP antibody
EIF3EIP antibody was raised using the N terminal of EIF3EIP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVTACC3 antibody
TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKESRPS3 antibody
The RPS3 antibody is a highly specialized monoclonal antibody that targets the histidine-rich protein S3 (RPS3). This antibody has been extensively studied in the field of Life Sciences and has shown promising results as an antiviral agent. It has been found to neutralize the activity of caspase-9, a key enzyme involved in apoptosis, and inhibit the growth of various viruses. The RPS3 antibody can also be used for research purposes, such as in Western blotting or immunohistochemistry assays. With its high specificity and affinity for the target molecule, this antibody is a valuable tool for scientists studying cellular signaling pathways, including those involving TGF-beta and epidermal growth factor. Whether you're conducting groundbreaking research or developing new therapeutic strategies, the RPS3 antibody is an essential component of your scientific toolkit.Caldesmon 1 antibody
Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLMEK1 antibody
The MEK1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to MEK1, a protein involved in signal transduction pathways. This antibody can be used for various applications, including research on androgen signaling, plasmid expression systems, adipose tissue biology, and hybridization techniques.p53 antibody
The p53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the p53 protein, which is a key regulator of cell growth and division. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and flow cytometry.HAL antibody
HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKTOR1B antibody
TOR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDAVPR1B antibody
The AVPR1B antibody is a highly effective monoclonal antibody that targets the AVPR1B receptor. This receptor plays a crucial role in various biological processes, including the regulation of stress response and social behavior. By specifically binding to the AVPR1B receptor, this antibody inhibits its activity and modulates the downstream signaling pathways.ATF4 antibody
The ATF4 antibody is a highly specific polyclonal antibody that is used in various life science applications. It specifically targets the activating transcription factor 4 (ATF4), which plays a crucial role in cellular processes such as growth, differentiation, and stress response.
PDCD2 antibody
The PDCD2 antibody is a highly specialized monoclonal antibody that targets a specific molecule in human hepatocytes. It is designed to recognize and bind to the carboxyl terminal of the target molecule, allowing for precise detection and analysis. This antibody is derived from a hybridoma cell line, resulting in a chimeric protein that combines the specificity of human antibodies with the stability of bovine γ-globulin. The PDCD2 antibody has been extensively tested in various Life Sciences applications, including hybridization studies and immunohistochemistry. Its unique properties make it an invaluable tool for researchers studying natriuretic factors, chemokines, and other important signaling molecules. Trust the PDCD2 antibody to provide accurate and reliable results in your experiments.TMEM16C antibody
TMEM16C antibody was raised using the middle region of TMEM16C corresponding to a region with amino acids WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFPurity:Min. 95%KCNA10 antibody
KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFWPEG10 antibody
The PEG10 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor GM-CSF (colony-stimulating factor). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications. It has been found to inhibit the activity of phosphatase, which plays a crucial role in cell growth and differentiation. Additionally, the PEG10 antibody has been shown to have an impact on adipocyte function, making it a promising candidate for research in obesity and metabolic disorders. With its high specificity and affinity for its target, this antibody is a valuable tool for scientists working in various areas of biomedical research.MGC51025 antibody
MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKHPLAT antibody
The PLAT antibody is a monoclonal antibody that specifically targets fibrinogen. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody has shown excellent binding affinity and specificity for fibrinogen, making it an ideal tool for various experimental techniques.Vitronectin antibody
Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.CRMP1 antibody
CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIPurity:Min. 95%Keratin 15 antibody
The Keratin 15 antibody is a glycopeptide that targets the human serum androgen. It is an essential tool for researchers in the field of Life Sciences, as it plays a crucial role in various cellular processes. This antibody specifically recognizes Keratin 15, which is a protein involved in the maintenance and integrity of epithelial tissues.NFIL3 antibody
The NFIL3 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to the NFIL3 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in experiments involving acetylation, methyl transferase activity, and the activation of antinociceptive pathways.NQO1 antibody
The NQO1 antibody is a highly specialized monoclonal antibody that has been developed for immunoassays. It is designed to specifically target and neutralize the NQO1 protein, which plays a crucial role in cellular processes such as collagen synthesis, growth factor signaling, and tyrosine kinase receptor activation. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting NQO1 in various biological samples.Podoplanin antibody
The Podoplanin antibody is a mouse monoclonal antibody that specifically targets the antigen binding domain of Podoplanin. This antibody is designed to recognize and bind to Podoplanin, a human protein that serves as a potential biomarker in various biological processes. The antibody has been extensively tested and validated for its specificity and sensitivity in detecting Podoplanin in different samples.
LIMK1 antibody
The LIMK1 antibody is a highly specialized phosphatase that plays a crucial role in various cellular processes. It binds to specific proteins and regulates their activity, making it an essential component for normal cell function. This antibody has been found to have antiangiogenic properties, meaning it inhibits the formation of new blood vessels. Additionally, it interacts with natriuretic peptides, which are hormones involved in regulating blood pressure and fluid balance. The LIMK1 antibody is commonly used in Life Sciences research to study the effects of growth factors such as epidermal growth factor and endothelial growth factor. Its unique binding properties make it a valuable tool for understanding complex signaling pathways and molecular interactions within cells.SARS M antibody
SARS M antibody was raised in Mouse using a purified recombinant fragment of SARS-m protein expressed in E. coli as the immunogen.DRB1 antibody
DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDMMP19 antibody
MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWROSR1 antibody
The OSR1 antibody is a powerful tool in the field of life sciences. It is an interferon and glucagon-neutralizing antibody that has been extensively used in various research studies. This polyclonal antibody specifically targets OSR1 (oxidative stress-responsive 1) protein, which plays a crucial role in cellular processes related to growth, development, and homeostasis.FGFR4 antibody
FGFR4 antibody was raised in Mouse using a purified recombinant fragment of FGFR4 expressed in E. coli as the immunogen.Calmodulin antibody
The Calmodulin antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets calmodulin, a protein that plays a crucial role in various cellular processes such as growth factor signaling, regulation of enzymes like pancreatic elastase, and calcium-dependent processes in human hepatocytes. This antibody has been extensively used in research to study the function and localization of calmodulin in different cell types and tissues.IKBKB antibody
IKBKB antibody was raised in Mouse using a purified recombinant fragment of IKBKB expressed in E. coli as the immunogen.PRSS3 antibody
PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHHNRPF antibody
HNRPF antibody was raised using the C terminal of HNRPF corresponding to a region with amino acids LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSEpoR antibody
The EpoR antibody is a life sciences product that specifically targets the erythropoietin receptor (EpoR). It is a polyclonal antibody that can be used in various applications, including research and diagnostics. The EpoR antibody binds to the EpoR protein, which is a nuclear receptor involved in erythropoiesis. By targeting this receptor, the antibody can modulate the signaling pathway and affect important biological processes such as red blood cell production.HBP1 antibody
The HBP1 antibody is a polyclonal antibody that targets hepatocyte growth factor. It is used in research and diagnostic applications to detect and quantify the expression levels of HBP1. This antibody specifically binds to HBP1 and can be used for various immunoassays, including Western blotting, immunohistochemistry, and ELISA. The HBP1 antibody has been shown to have high specificity and sensitivity in detecting HBP1 in various samples. It is a valuable tool for studying the role of HBP1 in different biological processes, such as cell growth, differentiation, and development. The HBP1 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. With its reliable performance and versatility, the HBP1 antibody is an essential tool for scientists working in the field of cellular biology and molecular medicine.FABP4 antibody
FABP4 antibody was raised in Mouse using a purified recombinant fragment of FABP4(aa61-121) expressed in E. coli as the immunogen.
Macrophage Scavenger Receptor antibody
Macrophage scavenger receptor antibody was raised in rat using Raw 264 cell line as the immunogen.IFN γ antibody (biotin)
IFN gamma antibody (biotin) was raised in mouse using human IFN-gamma as the immunogen.ATIC antibody
ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTRPSA antibody
RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYPurity:Min. 95%Protein S antibody (HRP)
Protein S antibody (HRP) was raised in goat using human Protein S purified from plasma as the immunogen.RHOB antibody
RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYDonkey anti Mouse IgG (H + L) (rhodamine)
Donkey anti-mouse IgG (H + L) (rhodamine) was raised in donkey using murine IgG (H&L) as the immunogen.NET1 antibody
NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRKCNN1 antibody
KCNN1 antibody was raised using the C terminal of KCNN1 corresponding to a region with amino acids KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD
hnRNPF antibody
The hnRNPF antibody is a polyclonal antibody that is used in various diagnostic applications. It is highly reactive and can be used to detect the presence of hnRNPF, a serine protease, in biological samples. This antibody has neutralizing properties and can be used to inhibit the activity of hnRNPF in experimental settings. It is commonly used as a diagnostic reagent in research laboratories and clinical settings.cSRC antibody
The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.
ARHGAP15 antibody
ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQPCI antibody
PCI antibody was raised in goat using human Protein C Inhibitor purified from plasma as the immunogen.Contactin 2 antibody
The Contactin 2 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets Contactin 2, a protein involved in cell adhesion and neuronal development. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including autoimmune disorders and cancer.
C14ORF130 antibody
C14ORF130 antibody was raised using the C terminal Of C14Orf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED
FAM26A antibody
FAM26A antibody was raised using the C terminal Of Fam26A corresponding to a region with amino acids RSELQARGLRRGNAGRRLELPAVPEPPEGLDSGSGKAHLRAISSREQVDRSTAT1 antibody
The STAT1 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the activated form of STAT1 protein. This antibody has been widely used in life sciences research to study various cellular processes and signaling pathways involving STAT1.Elk1 antibody
The Elk1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the Elk1 protein, which plays a crucial role in gene expression regulation. The Elk1 antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.p53 antibody
p53 antibody was raised in Mouse using a purified recombinant fragment of human p53 expressed in E. coli as the immunogen.ACOT12 antibody
ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVCD11a antibody (Azide Free)
CD11a antibody was raised in mouse using human CD11a (LFA-1a) as the immunogen.CD42c antibody
The CD42c antibody is a potent inhibitor that targets the platelet membrane. It acts as a metastasis inhibitor by preventing the attachment of cancer cells to platelets, thereby inhibiting their spread to other parts of the body. The CD42c antibody can be used in various applications, including in vitro experiments and life sciences research. It is commonly used in immunosorbent assays and can also be conjugated to liposomes or protein microparticles for targeted drug delivery. This polyclonal antibody specifically recognizes and binds to activated CD42c glycoprotein on platelets, providing a reliable tool for studying platelet function and related disorders. With its high specificity and efficacy, the CD42c antibody is an essential component for researchers and scientists working in the field of platelet biology and metastasis inhibition.
NET1 antibody
NET1 antibody was raised using the middle region of NET1 corresponding to a region with amino acids AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHGVEGFB antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive studies have demonstrated its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.MAT1A antibody
MAT1A antibody was raised using the C terminal of MAT1A corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVHTau antibody
The Tau antibody is a highly specialized Polyclonal Antibody that targets the annexin protein. It is commonly used in Life Sciences research for its ability to inhibit the activity of oncostatin and anti-cd33 antibodies. This monoclonal antibody offers a powerful tool for researchers studying the role of annexin in various cellular processes.CLPB antibody
CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALVGalectin 3 antibody
Galectin 3 antibody is an essential tool used in Life Sciences research. It is a polyclonal antibody that specifically targets galectin 3, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of galectin 3.NONO antibody
NONO antibody was raised using the N terminal of NONO corresponding to a region with amino acids KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK
IPKA antibody
The IPKA antibody is a histidine-rich growth factor that is capable of neutralizing autoantibodies. It belongs to the class of monoclonal antibodies and has shown promising results in various studies. The IPKA antibody has been extensively studied in the field of Life Sciences and has been found to have natriuretic and neuroprotective properties. It works by specifically targeting and binding to specific antigens, leading to an antigen-antibody reaction that helps in the activation of certain biological processes. With its unique properties, the IPKA antibody holds great potential for therapeutic applications in various fields.AGPAT3 antibody
AGPAT3 antibody was raised in rabbit using the middle region of AGPAT3 as the immunogen
Phkg1 antibody
Phkg1 antibody was raised in rabbit using the N terminal of Phkg1 as the immunogenPurity:Min. 95%IL1b antibody
The IL1b antibody is a specific antibody that is commonly used in the field of Life Sciences. This antibody is designed to specifically bind to IL1b, which is a protein involved in immune response and inflammation. The IL1b antibody can be used for various applications, including immobilization on an electrode for detection purposes. It recognizes tyrosine residues on IL1b and can be used to study the activation of this protein. Additionally, the IL1b antibody can be used in research related to cancer treatment, as it has been shown to have antagonist binding properties against oncogenic kinases such as epidermal growth factor receptor (EGFR). Overall, the IL1b antibody is a valuable tool for researchers studying immune response, inflammation, and cancer biology.
Beta-2-microglobulin monoclonal antibody
The Beta-2-microglobulin monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Beta-2-microglobulin, a protein found on the surface of cells. By binding to this protein, the antibody can modulate various cellular processes.Rab1A antibody
The Rab1A antibody is a highly effective growth factor that is used in the field of Life Sciences. This biochemical compound is available in both monoclonal and polyclonal forms, making it versatile for various applications. The Rab1A antibody works by inhibiting the activity of Rab1A, a protein involved in intracellular trafficking. By blocking this protein, the antibody prevents the transport of molecules within cells, thereby affecting cellular processes such as nuclear signaling and e-cadherin expression. With its high specificity and affinity, this antibody is an essential tool for researchers studying cellular mechanisms and developing new medicaments. Whether you're working on a colloidal microsphere or exploring inhibitors for specific pathways, the Rab1A antibody is an indispensable asset in your scientific arsenal. Trust its exceptional performance to deliver accurate results and advance your research in the field of Life Sciences.
