Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SMAD6 antibody
The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.GAL1 antibody
The GAL1 antibody is a highly specialized antibody that targets hepatocyte growth and lipase activity. It belongs to the class of monoclonal antibodies in Life Sciences. This antibody specifically binds to lipoprotein lipase (LPL) and apoa-I, which are key players in lipid metabolism. By targeting these molecules, the GAL1 antibody can modulate lipid levels and potentially have an impact on cardiovascular health. Additionally, this antibody has shown potential as a growth factor for certain cell types, such as endothelial cells, through its interaction with the growth hormone receptor. The GAL1 antibody is available in both monoclonal and polyclonal forms, offering researchers different options for their specific needs.Ubiquilin-Like antibody
Ubiquilin-Like antibody was raised using the middle region of UBQLNL corresponding to a region with amino acids LTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANTAMISTKGQSHIC
SMU1 antibody
SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVVTRPM3 antibody
TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDSMPD2 antibody
SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHAntithrombin III antibody (biotin)
Antithrombin III antibody (biotin) was raised in sheep using human antithrombin purified from plasma as the immunogen.CDK2 antibody
The CDK2 antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic antibody that specifically targets the CDK2 molecule, which plays a crucial role in cell cycle regulation and proliferation. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEECBP antibody
The CBP antibody is a highly effective inhibitor that targets nuclear proteins. It is a monoclonal antibody that specifically recognizes and binds to acetylated biomolecules. This antibody has been extensively studied and proven to be cytotoxic against various types of cells. In Life Sciences research, the CBP antibody is commonly used in reaction solutions for experiments involving brain natriuretic peptide (BNP) and other related growth factors. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The CBP antibody is supplied in buffered solutions, ensuring stability and maintaining its effectiveness throughout experiments.
RSRC2 antibody
RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSIL20R2 antibody
The IL20R2 antibody is a monoclonal antibody that is used in immunoassays to detect and quantify IL20R2 protein levels in human serum. It has been shown to have high specificity and sensitivity, making it an ideal tool for researchers studying the role of IL20R2 in various biological processes. This antibody can be used for applications such as Western blotting, ELISA, and immunohistochemistry. The IL20R2 antibody has also been used in molecular docking studies to understand its interaction with other molecules, providing valuable insights into its mechanism of action. With its ultrasensitive detection capabilities, this antibody is a valuable asset in the field of life sciences research.SLAIN1 antibody
SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSEVI1 antibody
EVI1 antibody was raised in mouse using recombinant Human Ecotropic Viral Integration Site 1 (Evi1)
CAMLG antibody
CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVTDRD9 antibody
TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPMEPHB6 antibody
EPHB6 antibody was raised in Mouse using a purified recombinant fragment of EPHB6 expressed in E. coli as the immunogen.TNNI3K antibody
TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY
C5ORF36 antibody
C5ORF36 antibody was raised using the N terminal Of C5Orf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWDSheep RBC antibody (FITC)
Sheep RBC antibody (FITC) was raised in rabbit using ovine erythrocytes as the immunogen.BRDU antibody
The BRDU antibody is a growth factor that belongs to the class of glycoproteins. It acts by binding to specific proteins and promoting cell growth and division. This monoclonal antibody is highly specific and targets activated cells, making it a valuable tool in cancer research and diagnostics. The BRDU antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. It is also cytotoxic, meaning it can selectively kill cells expressing the target protein. Additionally, this antibody has shown potential as an inhibitor of transmembrane conductance and has been implicated in the regulation of autoantibodies and chemokines. With its high specificity and versatility, the BRDU antibody is an essential tool for researchers studying cell growth and signaling pathways.AFP antibody
The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a growth factor found in adipose tissue. This antibody is widely used in life sciences research and has various applications in the field. It can be used as an inhibitor to study the function of AFP or as a tool to detect and measure AFP levels in biological samples.CR4 antibody
The CR4 antibody is a highly specialized monoclonal antibody that targets cholinergic growth factors, specifically choline acetyltransferase. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.HBsAg antibody
The HBsAg antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) in human serum. This antibody has been activated to enhance its binding affinity and effectiveness. It is commonly used in life sciences research, particularly in studies related to the detection and quantification of AFP levels. The HBsAg antibody can be utilized in various applications such as immunoassays, western blotting, and immunohistochemistry. Its high specificity ensures accurate and reliable results. Additionally, this antibody has been engineered to have low cross-reactivity with other molecules, ensuring minimal interference from potential inhibitors or colloidal substances. With its exceptional performance and reliability, the HBsAg antibody is an essential tool for researchers in the field of Life Sciences.HERC6 antibody
HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHPON1 antibody
The PON1 antibody is a monoclonal antibody that has the ability to neutralize the activity of paraoxonase 1 (PON1). PON1 is an enzyme that plays a crucial role in protecting against oxidative stress and inflammation. By binding to PON1, this antibody can inhibit its activity and prevent the harmful effects associated with oxidative stress.HPX antibody
The HPX antibody is a neutralizing antibody that targets interferon and autoantibodies. It has been shown to have a high affinity for hemoglobin and growth factors. This polyclonal antibody is capable of binding to various proteins, including alpha-fetoprotein, c-myc, telomerase, collagen, and fibronectin. The HPX antibody can form complexes with these proteins, leading to their neutralization and inhibition of their biological activities. This antibody is widely used in research and diagnostic applications for its ability to detect and quantify specific proteins in various samples. Its versatility and specificity make it an essential tool for studying protein-protein interactions and understanding the role of specific proteins in various biological processes.RARG antibody
The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It acts as a growth factor and has been shown to inhibit hepatocyte growth. This antibody can be used for various applications, including research and therapeutic purposes. It has been found to have cytotoxic effects on cancer cells, such as MCF-7, and can also enhance the efficacy of other anticancer drugs. The RARG antibody binds specifically to RARG and modulates its activity, affecting downstream signaling pathways involved in cell proliferation, differentiation, and apoptosis. It has also been shown to interact with other proteins, such as fibronectin and lipoprotein lipase. This versatile antibody is a valuable tool for studying the role of RARG in various biological processes and may have potential applications in cancer treatment.CYB5R3 antibody
The CYB5R3 antibody is a polyclonal antibody that plays a crucial role in various cholinergic and growth factor-related processes in Life Sciences. It is commonly used in research to study the cytotoxic effects of certain compounds on liver microsomes and dopamine metabolism. The CYB5R3 antibody specifically targets and binds to activated CYB5R3, an enzyme involved in electron transfer reactions. This binding inhibits the enzymatic activity of CYB5R3, leading to a decrease in the production of reactive oxygen species and neuroprotective effects. Additionally, this antibody has been shown to inhibit the expression of interleukin-6, a pro-inflammatory cytokine. The CYB5R3 antibody is produced by a hybridoma cell line, ensuring its high specificity and quality. Researchers can use this antibody as a valuable tool for studying the role of CYB5R3 in various biological processes and developing potential inhibitors for therapeutic applications.ITPK1 antibody
ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIRactopamine antibody
The Ractopamine antibody is a specific monoclonal antibody that has been developed for research purposes in the field of Life Sciences. This antibody has high affinity and specificity for Ractopamine, making it an ideal tool for detecting and quantifying this compound in various samples. It can be used in various immunoassays such as ELISA, Western blotting, and immunohistochemistry.NEK7 antibody
NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIIRS1 antibody
The IRS1 antibody is a monoclonal antibody that specifically targets insulin receptor substrate 1 (IRS1). This antibody plays a crucial role in regulating insulin signaling pathways and has been widely used in various studies related to diabetes, obesity, and metabolic disorders.P21 antibody
The P21 antibody is a highly specialized polyclonal antibody that is used in various fields of life sciences. It has a high viscosity, which allows for efficient binding to target molecules. This antibody is particularly effective in neutralizing tumor necrosis factor-alpha (TNF-α), interleukin-6, interferon, and other growth factors. Its monoclonal nature ensures a specific antigen-antibody reaction, making it suitable for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). Additionally, the P21 antibody can be used to detect virus surface antigens and has shown promising results as an anti-MERTK antibody. With its versatility and reliability, this antibody is an essential tool for researchers and scientists in the field of life sciences.LYSMD2 antibody
LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
Cyclin A antibody
The Cyclin A antibody is a highly specialized and potent phosphatase inhibitor that is widely used in industrial applications. It is a monoclonal antibody that specifically targets and binds to activated Cyclin A, preventing its interaction with protein kinases and inhibiting cell division. This antibody has shown great potential as an antidiabetic medicament, as it exhibits inhibitory effects on key enzymes involved in glucose metabolism. In addition, the Cyclin A antibody has been extensively studied in the field of Life Sciences, where it has been used for molecular docking and molecular modeling experiments. Its high affinity and specificity make it an invaluable tool for researchers in various scientific disciplines.CD91 antibody
The CD91 antibody is a highly versatile product in the field of Life Sciences. It has been extensively used in various applications such as 2-deoxyglucose assays, dermal fibroblasts studies, and antibody-based assays. This antibody has shown promising results in anti-thrombotic research and has been found to play a crucial role in ferroptosis regulation. Furthermore, it has been observed to act as a secretagogue in neuroendocrine cells and exhibit strong binding affinity towards dermal binding proteins like hsp90α. The CD91 antibody is also known for its excellent staining capabilities and its ability to interact with glucose transporters. With its wide range of applications and impressive performance, this antibody is an essential tool for researchers in the field of Life Sciences.ApoE antibody
The ApoE antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets apolipoprotein E, a protein involved in the transport and metabolism of fatty acids. This antibody has been extensively studied and shown to have various applications.EPHB3 antibody
The EPHB3 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the epidermal growth factor receptor EPHB3. This antibody is widely used in research to study the role of this growth factor in various biological processes.Troponin I Type 2 antibody
Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
CD11a antibody
The CD11a antibody is a monoclonal antibody that specifically targets the CD11a protein, which is found in human serum. This antibody has been extensively studied and shown to have high affinity and specificity for CD11a. It has been used in various research applications, including the study of autoimmune diseases such as diabetes and rheumatoid arthritis.KIAA0494 antibody
KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKVERAP1 antibody
The ERAP1 antibody is a monoclonal antibody that targets vascular endothelial growth factor (VEGF). It is activated by protein kinase and has anti-angiogenic properties. This antibody can be used in Life Sciences research to study the role of VEGF in various biological processes. It can also be used in diagnostic applications to detect autoantibodies or as a therapeutic agent for conditions involving abnormal angiogenesis. The ERAP1 antibody has shown efficacy in inhibiting the growth of cancer cells and has been used in combination with other targeted therapies such as sorafenib and anti-HER2 antibodies. Its specificity for VEGF makes it a valuable tool in understanding and manipulating angiogenic pathways.ATP5A1 antibody
The ATP5A1 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used in various chromatographic techniques to detect and analyze specific proteins and molecules. This antibody has been extensively studied and validated for its specificity and sensitivity.LRRC50 antibody
LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLK2 antibody
The K2 antibody is a highly specialized monoclonal antibody that targets tyrosine and has various applications in the field of life sciences. This antibody has been extensively studied for its interaction with liver microsomes, collagen, TNF-α, and influenza hemagglutinin. It is commonly used as a cross-linking agent in colloidal and immunological assays.Cofilin antibody
The Cofilin antibody is a powerful tool in the field of Life Sciences. It targets cofilin, a protein kinase that plays a crucial role in cell movement and migration. The antibody has been extensively tested and validated for its specificity and effectiveness in various applications.Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.LOX antibody
The LOX antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and detects the anti-apoptotic protein LOX. With its ultrasensitive detection capabilities, this antibody allows for precise and accurate measurement of LOX levels in various samples.GK2 antibody
GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSFADD antibody
The FADD antibody is a highly specific and sensitive polyclonal antibody that is used in various research applications. It has been developed using state-of-the-art spectrometric and mass spectrometric methods to ensure its quality and reliability.Src antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug's effectiveness has been proven through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its oxidative metabolites undergo hydrolysis by esterases, reduction by glutathione reductase, and oxidation by cytochrome p450 enzymes. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth. With its impressive features, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an indispensable tool in the fight against tuberculosis.Crystallin Beta A1 antibody
Crystallin Beta A1 antibody was raised using the N terminal of CRYBA1 corresponding to a region with amino acids METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS
Diphtheria toxin antibody
Diphtheria toxin antibody was raised in mouse using Intact toxin/toxoid as the immunogen.IkB alpha antibody
The IkB alpha antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activated form of IkB alpha, a protein that plays a crucial role in cellular signaling pathways. By binding to IkB alpha, this antibody prevents its interaction with 14-3-3 isoforms, thereby inhibiting downstream signaling events.
DDX5 antibody
The DDX5 antibody is a powerful tool in the field of Life Sciences. It is an acid complex that consists of both polyclonal and monoclonal antibodies. This antibody specifically targets DDX5, a growth factor involved in various cellular processes. By binding to DDX5, the antibody can modulate its activity and inhibit its function.
cFOS antibody
The cFOS antibody is a highly effective inhibitor that is widely used in various assays and experiments. This monoclonal antibody specifically targets the cFOS protein, which plays a crucial role in cellular processes such as cell growth, differentiation, and apoptosis. By inhibiting the activity of cFOS, this antibody allows researchers to study the function and regulation of this protein in different biological systems.
Progesterone Receptor antibody
The Progesterone Receptor antibody is a powerful tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, allowing for flexibility in experimental design. The antibody specifically targets the progesterone receptor, a key protein involved in various physiological processes.ApoB antibody
The ApoB antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying various biological processes, including tissue transglutaminase and the production of antibodies. This monoclonal antibody is designed to specifically bind to the recombinant antigen, allowing for accurate detection and analysis in assays. The ApoB antibody is buffered to ensure stability and optimal performance in experiments. With its high affinity and specificity, researchers can rely on this antibody to provide reliable results. Whether studying activated proteins or analyzing human serum samples, the ApoB antibody is a valuable asset in any laboratory setting.Goat anti Rat IgM (FITC) (mu chain specific)
Goat anti-rat IgM (FITC) (mu chain specific) was raised in goat using rat IgM, Mu chain as the immunogen.RBM22 antibody
RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
DYNC1I1 antibody
DYNC1I1 antibody was raised using the N terminal of DYNC1I1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPBeta Lactamase 2 antibody
Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE
KIAA0460 antibody
KIAA0460 antibody was raised using the middle region of KIAA0460 corresponding to a region with amino acids LQGTLAEHFGVLPGPRDHGGPTQRDLNGPGLSRVRESLTLPSHSLEHLGPC3orf49 antibody
C3orf49 antibody was raised using the middle region of C3orf49 corresponding to a region with amino acids IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPHGPR116 antibody
The GPR116 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets GPR116, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting GPR116 in different experimental settings.CD90 antibody (Azide Free)
CD90 antibody (Azide free) was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.PABPC4 antibody
PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSSFRP2 antibody
The SFRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly employed in immunohistochemistry studies to detect the presence of trpv4, an ion channel protein involved in various cellular processes. This antibody has been shown to be effective in neutralizing the activity of SFRP2, an endogenous inhibitor of trpv4. By blocking the interaction between SFRP2 and trpv4, this antibody allows for the activation of trpv4 and subsequent downstream signaling pathways. Additionally, this antibody has been found to inhibit the production of pro-inflammatory cytokines such as TNF-α and IFN-γ, making it a valuable tool in studying immune responses and inflammatory conditions like endotoxemia. Researchers can rely on this high-quality SFRP2 antibody to accurately detect and manipulate trpv4 activity in their experiments.CA3 antibody
The CA3 antibody is a monoclonal antibody that plays a crucial role in the field of life sciences. It is specifically designed to target and bind to receptors such as glucagon, collagen, and other binding proteins. This antibody has been extensively studied and proven to be effective in various immunoassays.IL6 antibody
The IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various biological processes. This antibody is widely used in Life Sciences research to study the role of IL-6 in different disease models and pathways.CKS2 antibody
The CKS2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the interleukin-6 (IL-6) molecule and has been shown to inhibit syncytia formation, which is the fusion of cells into large multinucleated cells. This antibody binds to the antigen binding domain of IL-6 and prevents its interaction with other molecules involved in syncytia formation. The CKS2 antibody is commonly used in studies investigating the role of IL-6 in various biological processes, such as immune responses and inflammation. Its specificity and high affinity make it a valuable tool for researchers studying IL-6 signaling pathways and potential therapeutic interventions.α Actinin 4 antibody
alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVITransferrin Receptor antibody
The Transferrin Receptor antibody is a collagen-based product that falls under the category of Life Sciences. It is a monoclonal antibody specifically designed to target and bind to the transferrin receptor, which plays a crucial role in iron metabolism. This antibody has been extensively studied and proven effective in various research applications.
CD14 antibody
The CD14 antibody is a monoclonal antibody used in Life Sciences research. It is known for its cell proliferation inhibitory properties and its ability to target tumor necrosis factor-alpha (TNF-α). The CD14 antibody can be used in various applications, including electrode hybridization, cytotoxic assays, chromatographic techniques, and cell lysis. Additionally, this antibody has been found to have neuroprotective effects and can inhibit the activity of hydrogen fluoride. The CD14 antibody is also commonly used in the development of therapeutic strategies targeting specific antigens, such as the anti-CD33 antibody. With its wide range of applications and effectiveness, the CD14 antibody is a valuable tool for researchers in the field of Life Sciences.HIBADH antibody
HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGUSP7 antibody
The USP7 antibody is a histidine-rich monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to USP7, a protein involved in various cellular processes such as dopamine and steroid metabolism, glycosylation, and activation of phosphatase. This antibody has been extensively studied for its role in growth factor signaling pathways and has shown promising results in inhibiting the growth of certain cancer cells. Additionally, the USP7 antibody has been used to detect autoantibodies and study their association with diseases such as autoimmune disorders and hepatocyte growth. Its unique fatty acid isothiocyanate conjugation allows for efficient labeling and detection in experimental settings. With its specificity and versatility, the USP7 antibody is an invaluable tool for researchers in the field of Life Sciences.POLR1B antibody
POLR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDCTNNB1 antibody
The CTNNB1 antibody is a high-specificity, monoclonal antibody that is widely used in the field of life sciences. It is known for its antiviral properties and its ability to target CTNNB1, a protein involved in various cellular processes. This antibody has a low density and can effectively bind to collagen and glycan structures. It can also be used in the detection of alpha-fetoprotein and interferon.Vitronectin antibody
The Vitronectin antibody is a monoclonal antibody used in the field of Life Sciences. It is derived from murine monoclonal antibodies and is specifically designed to target and bind to vitronectin, a glycoprotein involved in various biological processes. This antibody has been extensively characterized and validated for its high specificity and affinity towards vitronectin.KLF4 antibody
KLF4 antibody was raised in Mouse using a purified recombinant fragment of human KLF4 expressed in E. coli as the immunogen.TFPI antibody
TFPI antibody is an effective tool for studying thrombotic microangiopathy. It specifically targets actin filaments, which play a crucial role in the development of this condition. This drug antibody can be used in both polyclonal and monoclonal forms, making it versatile for various research applications in life sciences. TFPI antibody is particularly useful in investigating atypical hemolytic conditions and can provide valuable insights into their underlying mechanisms. Researchers can utilize this antibody to determine the optimal dosage and efficacy of inhibitors or other therapeutic interventions. Additionally, TFPI antibody is compatible with histidine staining and phalloidin labeling techniques, enabling precise visualization of actin structures. Its binding specificity makes it an essential tool for studying glucose transporter regulation and other related processes.
Vimentin antibody
The Vimentin antibody is a highly effective tool for research in the field of Life Sciences. It is a monoclonal antibody that specifically targets vimentin, a type III intermediate filament protein found in various cell types. Vimentin plays a crucial role in maintaining cell structure and integrity, and it is involved in processes such as cell migration, adhesion, and signaling.
GLP1 antibody
The GLP1 antibody is a neutralizing antibody used in Life Sciences research. It has an inhibitory effect on protein kinase activity and chemokine signaling, making it a valuable tool for studying these processes. The GLP1 antibody specifically targets glucagon-like peptide 1 (GLP-1), a hormone involved in glucose homeostasis. This antibody can be used in various applications, including the development of inhibitors and therapeutic antibodies. It is commonly used as a control antibody in experiments to ensure accurate and reliable results. The GLP1 antibody is available as a monoclonal antibody and can be conjugated with different polymers for specific detection purposes. With its high specificity and potency, the GLP1 antibody is an essential tool for researchers in the field of Life Sciences.STAT3 antibody
The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.
TMEFF2 antibody
The TMEFF2 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It has been extensively studied for its ability to inhibit the activity of TMEFF2, a protein involved in various cellular processes. Through molecular docking studies, it has been determined that this antibody binds to TMEFF2 and prevents its interaction with other molecules, thereby immobilizing its function.FADD antibody
FADD antibody was raised in mouse using recombinant human FADD (1-208aa) purified from E. coli as the immunogen.
KSHV ORF26 antibody
KSHV ORF26 antibody was raised in Mouse using a purified recombinant fragment of KSHV ORF26 expressed in E. coli as the immunogen.nNOS antibody
The nNOS antibody is a highly specialized cytotoxic antibody used in the field of Life Sciences. It is an essential tool for researchers studying various cellular processes, such as phosphatase activity and epidermal growth factor (EGF)-like signaling pathways. This monoclonal antibody specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. By blocking the activity of nNOS, this antibody can modulate important cellular functions, including chemokine production and growth factor signaling.CALML5 antibody
The CALML5 antibody is a substance used in the field of Life Sciences for various applications. It is an antigen that can be used for gas-liquid interface studies and has been shown to interact with lyso-gb1, a molecule involved in antinociceptive responses. The CALML5 antibody can be used in research experiments to detect and analyze the presence of CALML5 in samples. It is also commonly used as a tool in vaccine development and as an inhibitor in studies involving pluripotent stem cells. Additionally, this antibody has been explored for its potential therapeutic applications, such as being an HDAC inhibitor or targeting collagen-related disorders.IL3 antibody
IL3 antibody was raised in rabbit using highly pure recombinant human IL-3 as the immunogen.TEX14 antibody
TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN
Aurora Kinase A antibody
The Aurora Kinase A antibody is a highly specific monoclonal antibody that targets nuclear β-catenin. It is widely used in life sciences research to study the role of this protein in various cellular processes, including cell division and growth regulation. This antibody has been shown to effectively detect non-phosphorylated β-catenin in both acidic and colloidal environments.
DDX42 antibody
DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYMPFKL antibody
The PFKL antibody is a molecule drug that is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including insulin signaling and endothelial growth. This antibody has been shown to be highly effective in activating anticoagulant pathways and preventing blood clot formation. Additionally, it has been found to have a positive impact on albumin levels and stimulate endogenous hematopoietic activity.Adducin beta 2 antibody
Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS
CD28 antibody (Azide Free)
CD28 antibody (Azide free) was raised in hamster using CD28 costimulatory receptor as the immunogen.FAM76B antibody
FAM76B antibody was raised using the middle region of FAM76B corresponding to a region with amino acids QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSS
