Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
OAS2 antibody
OAS2 antibody was raised using the middle region of OAS2 corresponding to a region with amino acids AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEPurity:Min. 95%TRMT6 antibody
TRMT6 antibody was raised in rabbit using the middle region of TRMT6 as the immunogenPurity:Min. 95%ZFP42 antibody
ZFP42 antibody was raised in rabbit using the middle region of ZFP42 as the immunogenPurity:Min. 95%SIRT7 antibody
SIRT7 antibody was raised in rabbit using the C terminal of SIRT7 as the immunogenPurity:Min. 95%ZNF433 antibody
ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogenPurity:Min. 95%CD298 antibody
The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.
Purity:Min. 95%SERTAD2 antibody
SERTAD2 antibody was raised in rabbit using the N terminal of SERTAD2 as the immunogenPurity:Min. 95%SNRPA antibody
SNRPA antibody was raised in rabbit using the N terminal of SNRPA as the immunogen
Purity:Min. 95%WNT2B antibody
WNT2B antibody was raised in rabbit using the middle region of WNT2B as the immunogenPurity:Min. 95%Armcx1 antibody
Armcx1 antibody was raised in rabbit using the C terminal of Armcx1 as the immunogenPurity:Min. 95%Rad21 antibody
Rad21 antibody was raised in rabbit using the N terminal of Rad21 as the immunogenPurity:Min. 95%LRRC59 antibody
LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL
Purity:Min. 95%TMPRSS4 antibody
TMPRSS4 antibody was raised in rabbit using the N terminal of TMPRSS4 as the immunogenPurity:Min. 95%KCNG1 antibody
KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDPurity:Min. 95%CLPTM1L antibody
CLPTM1L antibody was raised using the middle region of CLPTM1L corresponding to a region with amino acids KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD
Purity:Min. 95%ACBD4 antibody
ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT
Purity:Min. 95%ZNF714 antibody
ZNF714 antibody was raised in rabbit using the N terminal of ZNF714 as the immunogenPurity:Min. 95%C19orf2 antibody
C19orf2 antibody was raised in rabbit using the middle region of C19ORF2 as the immunogen
Purity:Min. 95%IL7 antibody
IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.Purity:Min. 95%Tenomodulin antibody
Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK
Purity:Min. 95%RALA antibody
RALA antibody was raised in rabbit using the middle region of RALA as the immunogenPurity:Min. 95%ZNF266 antibody
ZNF266 antibody was raised in rabbit using the N terminal of ZNF266 as the immunogenPurity:Min. 95%CASP6 antibody
CASP6 antibody was raised in rabbit using the middle region of CASP6 as the immunogenPurity:Min. 95%SGK3 antibody
SGK3 antibody was raised using the N terminal of SGK3 corresponding to a region with amino acids LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH
Purity:Min. 95%MED4 antibody
MED4 antibody was raised in rabbit using the C terminal of MED4 as the immunogen
Purity:Min. 95%ZNF554 antibody
ZNF554 antibody was raised in rabbit using the N terminal of ZNF554 as the immunogenPurity:Min. 95%UCHL5 antibody
UCHL5 antibody was raised in rabbit using the C terminal of UCHL5 as the immunogenPurity:Min. 95%FAM53A antibody
FAM53A antibody was raised in rabbit using the C terminal of FAM53A as the immunogenPurity:Min. 95%ZNF675 antibody
ZNF675 antibody was raised in rabbit using the N terminal of ZNF675 as the immunogenPurity:Min. 95%CYP4B1 antibody
CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW
Purity:Min. 95%RER1 antibody
RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFPurity:Min. 95%FGD1 antibody
FGD1 antibody was raised in rabbit using the N terminal of FGD1 as the immunogen
Purity:Min. 95%CYP2A6 antibody
CYP2A6 antibody was raised in rabbit using the C terminal of CYP2A6 as the immunogenPurity:Min. 95%MIP5 antibody
MIP5 antibody was raised in goat using highly pure recombinant human MIP-5 as the immunogen.
Purity:Min. 95%ARNT2 antibody
The ARNT2 antibody is a high-flux monoclonal antibody that specifically targets the ARNT2 antigen. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays. It is commonly used as a serum marker for the detection of ARNT2 autoantibodies and can be utilized in the development of diagnostic tests and therapeutic medicines. The ARNT2 antibody has also been investigated for its potential role in modulating interleukin signaling pathways and inhibiting the activity of sirtuins, which are enzymes involved in cellular processes. With its specificity and versatility, this antibody is a valuable tool for researchers and clinicians alike.Purity:Min. 95%ZNF799 antibody
ZNF799 antibody was raised in rabbit using the n terminal of ZNF799 as the immunogenPurity:Min. 95%RAD54L antibody
RAD54L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
Purity:Min. 95%BATF2 antibody
BATF2 antibody was raised in rabbit using the middle region of BATF2 as the immunogenPurity:Min. 95%CIP29 antibody
CIP29 antibody was raised in rabbit using the C terminal of CIP29 as the immunogenPurity:Min. 95%SLC25A11 antibody
SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLPurity:Min. 95%ZNF589 antibody
ZNF589 antibody was raised in rabbit using the middle region of ZNF589 as the immunogen
Purity:Min. 95%CD3E antibody
CD3E antibody was raised in rabbit using the middle region of CD3E as the immunogenPurity:Min. 95%Galnt11 antibody
Galnt11 antibody was raised in rabbit using the N terminal of Galnt11 as the immunogenPurity:Min. 95%CHCHD8 antibody
CHCHD8 antibody was raised in rabbit using the middle region of CHCHD8 as the immunogenPurity:Min. 95%SLC24A6 antibody
SLC24A6 antibody was raised using the middle region of SLC24A6 corresponding to a region with amino acids SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE
Purity:Min. 95%EWSR1 antibody
EWSR1 antibody was raised in rabbit using the middle region of EWSR1 as the immunogenPurity:Min. 95%NLGN4X antibody
NLGN4X antibody was raised using the N terminal of NLGN4X corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENPurity:Min. 95%DHRS2 antibody
DHRS2 antibody was raised in rabbit using the N terminal of DHRS2 as the immunogenPurity:Min. 95%WNT4 antibody
WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEPurity:Min. 95%PEX10 antibody
PEX10 antibody was raised using the middle region of PEX10 corresponding to a region with amino acids QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVLPurity:Min. 95%UFD1L antibody
UFD1L antibody was raised in rabbit using the middle region of UFD1L as the immunogenPurity:Min. 95%Mesothelin antibody
Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF
Purity:Min. 95%FGF16 antibody
FGF16 antibody was raised in goat using highly pure recombinant human FGF-16 as the immunogen.
Purity:Min. 95%TUSC4 antibody
TUSC4 antibody was raised in rabbit using the N terminal of TUSC4 as the immunogen
Purity:Min. 95%Gtf2b antibody
Gtf2b antibody was raised in rabbit using the N terminal of Gtf2b as the immunogenPurity:Min. 95%PRR5 antibody
PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGSPurity:Min. 95%LYN antibody
The LYN antibody is a highly specialized monoclonal antibody used in Life Sciences. It has neutralizing properties and is particularly effective against antiphospholipid antibodies found in human serum. This antibody specifically targets the 5-ht7 receptor, which plays a crucial role in various physiological processes.
Purity:Min. 95%POMT2 antibody
POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
Purity:Min. 95%ZNF543 antibody
ZNF543 antibody was raised in rabbit using the middle region of ZNF543 as the immunogen
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%TMEM146 antibody
TMEM146 antibody was raised using the middle region of TMEM146 corresponding to a region with amino acids NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA
Purity:Min. 95%PAPPA2 antibody
PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLPurity:Min. 95%ZBTB2 antibody
ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen
Purity:Min. 95%MGP antibody
MGP antibody was raised using the middle region of MGP corresponding to a region with amino acids INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM
Purity:Min. 95%Scfd2 antibody
Scfd2 antibody was raised in rabbit using the middle region of Scfd2 as the immunogenPurity:Min. 95%4EBP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Purity:Min. 95%BAIAP2L2 antibody
The BAIAP2L2 antibody is a polyclonal antibody that targets the colony-stimulating factor. It is widely used in life sciences research to study various biological processes. This antibody specifically binds to BAIAP2L2, which plays a crucial role in cell growth and development. By targeting this protein, the BAIAP2L2 antibody can help researchers gain insights into the mechanisms involved in cellular processes such as actin filament formation, growth factor signaling, and steroid and glucagon production. Additionally, this antibody has been shown to inhibit the activity of TGF-β1, a potent growth factor involved in cell proliferation and differentiation. With its high specificity and effectiveness, the BAIAP2L2 antibody is an invaluable tool for scientists studying cellular pathways and developing potential therapeutic inhibitors.Purity:Min. 95%ZNF557 antibody
ZNF557 antibody was raised in rabbit using the middle region of ZNF557 as the immunogenPurity:Min. 95%Chromogranin A antibody
Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQPurity:Min. 95%GRO γ antibody
GRO gamma antibody was raised in rabbit using highly pure recombinant hGRO-gamma as the immunogen.Purity:Min. 95%ATG4D antibody
ATG4D antibody was raised in rabbit using the middle region of ATG4D as the immunogenPurity:Min. 95%SERPINE1 antibody
SERPINE1 antibody was raised in rabbit using the middle region of SERPINE1 as the immunogenPurity:Min. 95%TRIM31 antibody
The TRIM31 antibody is a polyclonal antibody that specifically targets insulin. It is widely used in the field of life sciences for its ability to neutralize insulin and study its effects on various biological processes. This antibody can be used in experiments involving acetyltransferase activity, as well as in studies investigating the interaction between insulin and other proteins such as E-cadherin, β-catenin, fibronectin, collagen, and more. The TRIM31 antibody has also been shown to have cytotoxic effects on certain cells, making it a valuable tool for researchers studying autoimmune diseases and the role of autoantibodies. With its high specificity and versatility, this antibody is an essential component of any laboratory studying insulin-related processes.WNT2B antibody
WNT2B antibody was raised using the N terminal of WNT2B corresponding to a region with amino acids MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLCD8 antibody (biotin)
Mouse monoclonal CD8 antibody (biotin); target human; IgG1 kappa; 20 ul (0.25 ug)/testPAR1 antibody
PAR1 antibody was raised in Mouse using a purified recombinant fragment of PAR1 expressed in E. coli as the immunogen.SLC38A1 antibody
SLC38A1 antibody was raised using the middle region of SLC38A1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDAPP antibody
The APP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to amyloid precursor protein (APP), which plays a crucial role in the development of Alzheimer's disease. This antibody has been extensively tested and proven to have high specificity and sensitivity for detecting extracellular histones, collagen, and other proteins involved in various biological processes.
HP1BP3 antibody
HP1BP3 antibody was raised using the N terminal of HP1BP3 corresponding to a region with amino acids SEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKD
Neuropsin antibody
The Neuropsin antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets and neutralizes the activity of Neuropsin, an enzyme involved in various physiological processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the areas of ophthalmology and neurology.SAMHD1 antibody
The SAMHD1 antibody is a monoclonal antibody that targets the SAMHD1 protein. SAMHD1 is a glycoprotein that plays a crucial role in cell growth and proliferation. It acts as a binding protein for various growth factors, chemokines, and interferons, regulating their activity and signaling pathways.CD74 antibody
The CD74 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to the CD74 protein, which plays a crucial role in immune responses. This antibody has been shown to inhibit the production of reactive oxygen species and interferon, making it a valuable tool for studying immune system regulation. Additionally, the CD74 antibody can be used to detect autoantibodies and analyze their interactions with cellular components. With its high affinity and specificity, this antibody provides reliable results in various applications such as immunohistochemistry, flow cytometry, and Western blotting. Researchers can trust the CD74 antibody to deliver accurate and reproducible results in their experiments.
ADCK3 antibody
The ADCK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the CD33 protein, as well as VEGF (vascular endothelial growth factor). This antibody has shown promising results in inhibiting the growth of various cancer cells, including MCF-7 breast cancer cells. Additionally, it has been found to have cytotoxic effects on mesenchymal stem cells and can neutralize the activity of circumsporozoite protein, which is involved in malaria infection. The ADCK3 antibody also exhibits properties similar to trastuzumab and adalimumab, acting as a family kinase inhibitor and a potent anti-inflammatory agent. Its versatility and effectiveness make it a valuable tool for researchers in the field of Life Sciences.L1CAM antibody
The L1CAM antibody is a monoclonal antibody that specifically targets the L1 cell adhesion molecule (L1CAM), a protein expressed in various tissues. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as an inhibitor of L1CAM-mediated growth factor signaling pathways. It has been used in assays to study the activation of L1CAM and its role in various cellular processes. The L1CAM antibody has also demonstrated cytotoxic activity against cells expressing high levels of L1CAM, making it a potential therapeutic option for certain types of cancer. Additionally, this antibody has been found to have vasoactive properties, potentially affecting vascular function. With its ability to target L1CAM and its diverse range of applications, the L1CAM antibody holds great potential for further research and development in the field of biomedicine.CDCA7L antibody
CDCA7L antibody was raised using the middle region of CDCA7L corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVEDSCN8A antibody
SCN8A antibody was raised using the middle region of SCN8A corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCFKBP52 antibody
The FKBP52 antibody is a highly specialized monoclonal antibody that has the ability to neutralize the effects of angptl3, a growth factor involved in adipose tissue regulation. This antibody can be used in various life sciences applications, such as research and diagnostics. It specifically targets FK506-binding protein 52 (FKBP52), which plays a crucial role in modulating protein phosphatase activity. The FKBP52 antibody can effectively inhibit the interaction between FKBP52 and its target proteins, thereby preventing downstream signaling events. It has been extensively tested and validated for use in various experimental settings, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays. With its high specificity and affinity for FKBP52, this antibody is an essential tool for researchers studying the complex mechanisms underlying cellular processes related to adipose tissue regulation and growth factor signaling pathways.p53 antibody
The p53 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively studied and proven to be effective in various applications.Norovirus G2 antibody
Norovirus G2 antibody is a monoclonal antibody that specifically targets the G2 strain of norovirus. It is derived from human serum and has been shown to form dimers, which enhance its binding affinity and effectiveness. This antibody works by immobilizing the virus, preventing it from infecting host cells and causing illness. Norovirus G2 antibody is widely used in Life Sciences research for studying the virus and developing diagnostic tools. It can be used in various applications, such as immunoassays, Western blotting, and immunohistochemistry. This antibody has also shown potential therapeutic applications in the treatment of norovirus infections.SNX4 antibody
The SNX4 antibody is a polyclonal antibody that is widely used in Life Sciences research. It plays a crucial role in various cellular processes, including the regulation of ornithine and the transport of multidrug resistance proteins. This antibody has been extensively studied for its ability to neutralize the activity of growth factors and inhibitors, such as ketamine, transferrin, low-molecular-weight compounds, interferon, collagen, and epidermal growth factor. Its high specificity and affinity make it an ideal tool for studying the function of these molecules in different biological systems. Additionally, the SNX4 antibody can be used in techniques such as immunohistochemistry and Western blotting to detect and quantify the expression levels of target proteins. With its excellent performance and reliability, this antibody is a valuable asset for researchers in various fields.
GLUT1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing bacterial growth. Extensive research has been conducted on this drug using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.DNASE2B antibody
DNASE2B antibody was raised using the C terminal of DNASE2B corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD
RIPK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. Extensive research has demonstrated its high efficacy in human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at elevated levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.RSPH10B antibody
RSPH10B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNCD23 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, which effectively prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.BMPR2 antibody
The BMPR2 antibody is a polyclonal antibody that specifically targets the bone morphogenetic protein receptor 2 (BMPR2). This receptor plays a crucial role in various cellular processes, including cell growth, differentiation, and development. The BMPR2 antibody can be used in various life science research applications to study the function and regulation of this receptor.
CPA1 antibody
The CPA1 antibody is an inhibitor that targets the epidermal growth factor receptor (HER2). It is a monoclonal antibody that specifically binds to HER2, preventing its activation and signaling cascade. This antibody has been used in anti-HER2 antibody-drug conjugates, where it is conjugated with a cytotoxic drug to selectively deliver the drug to HER2-positive cancer cells. The CPA1 antibody has shown promising results in preclinical studies, inhibiting tumor growth and improving overall survival. Additionally, this antibody has been investigated for its potential therapeutic effects in other diseases such as fatty acid metabolism disorders, tyrosine kinase-driven cancers, c-myc overexpression, and alpha-synuclein aggregation associated with neurodegenerative diseases. With its wide range of applications in life sciences research and potential therapeutic use, the CPA1 antibody holds great promise in advancing our understanding and treatment of various conditions related to epidermal growth factor signaling.Calpastatin antibody
Calpastatin antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-Calpastatin as the immunogen.CD172a antibody
The CD172a antibody is a highly effective polyclonal antibody that promotes endothelial growth. It can also be used as a monoclonal antibody to detect the presence of CD172a in human serum. This antibody has been shown to inhibit the activity of interleukin-6, a cytokine involved in inflammation and immune response. Additionally, it has been found to bind to albumin, a protein found in the blood, and specifically target cardiomyocytes, which are heart muscle cells. The CD172a antibody activates mitogen-activated protein kinase kinase kinase (MAP3K), which is an important enzyme involved in cell signaling pathways. In summary, this antibody plays a crucial role in various life sciences applications by targeting specific proteins and regulating cellular processes through protein kinase activation.ETV4 antibody
ETV4 antibody was raised in Mouse using a purified recombinant fragment of human ETV4 (aa50-109) expressed in E. coli as the immunogen.EXO1 antibody
The EXO1 antibody is a substance that specifically targets and binds to an antigen. It has been extensively studied and proven effective in various research applications. The antibody can be used in gas-liquid interface experiments to study the phosphorylation site of specific proteins. Additionally, it has shown potential as a vaccine strain for the development of new medicines.PRKACB antibody
PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIDSCR1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this medication inhibits bacterial growth, preventing transcription and replication. Its bactericidal activity has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.BAD antibody
The BAD antibody is a growth factor that is commonly used in Life Sciences research. It is an amino-terminal globulin that binds to acidic binding proteins. This polyclonal antibody has antiangiogenic properties and can be used to study various signaling pathways, including those involving phosphatase and β-catenin. Additionally, the BAD antibody can be used to detect the presence of specific proteins, such as epidermal growth factor, brain natriuretic peptide, and natriuretic peptides. Its high specificity and sensitivity make it a valuable tool for researchers in the field.SCGN antibody
SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINPPTBP1 antibody
The PTBP1 antibody is a monoclonal antibody that specifically targets and inhibits the function of PTBP1, a protein involved in various cellular processes. This antibody can be used as a research tool to study the role of PTBP1 in different biological systems. It is also useful for developing inhibitors or therapeutic antibodies targeting PTBP1 for potential clinical applications. The PTBP1 antibody is widely used in life sciences research, including studies on growth factors, oncogenic kinases, and binding proteins. Its high affinity and specificity make it an ideal tool for experiments involving immobilization on electrodes or other surfaces. By blocking the activity of PTBP1, this antibody can help uncover new insights into the regulation of cellular processes and potentially lead to the development of novel therapies targeting PTBP1-related diseases.CD154 antibody (Azide Free)
CD154 antibody was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.DNase I antibody
The DNase I antibody is a powerful medicament used in immunohistochemistry. It belongs to the class of Polyclonal Antibodies, which are known for their high specificity and affinity. This antibody specifically targets tyrosine residues on collagen, growth factors, and membrane-spanning polypeptides. It can be used in various Life Sciences applications, including research and diagnostic purposes.
MYB antibody
The MYB antibody is a monoclonal antibody that specifically targets the MYB protein. It has been extensively studied and proven to be highly effective in various applications. This antibody has been used in research settings to detect MYB expression levels in different cell types, including human hepatocytes. It has also been used to study the role of MYB in cancer development and progression.NR4A1 antibody
NR4A1 antibody was raised using the middle region of NR4A1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL
Galectin 3 antibody
Galectin 3 antibody is a highly specialized agent that targets and neutralizes galectin 3, a protein involved in various biological processes. This antibody has been shown to inhibit the interaction between galectin 3 and its binding partners, such as collagen and fatty acids. By doing so, it can help regulate processes like cell adhesion, inflammation, and immune response. Galectin 3 antibody is widely used in life sciences research to study the role of galectin 3 in different diseases and conditions. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and efficacy, galectin 3 antibody is an invaluable tool for understanding the complex mechanisms underlying various biological processes.
REX1 antibody
The REX1 antibody is a highly effective medicine that targets the interferon-stimulated gene and serves as a serum marker for various conditions. It plays a crucial role in regulating dopamine levels and methyl transferase activity, making it an essential component in maintaining optimal brain function. Additionally, this antibody enhances transmembrane conductance and promotes the activation of pluripotent stem cells. With its potent properties, the REX1 antibody is widely used in the development of monoclonal antibodies for therapeutic purposes. Furthermore, it has shown promising results in inhibiting the production of autoantibodies and anti-mesothelin antibodies, making it a valuable tool in combating autoimmune diseases.SAS10 antibody
SAS10 antibody was raised in mouse using recombinant Human Utp3, Small Subunit (Ssu) Processome Component, Homolog (S. Cerevisiae) (Utp3)SNX1 antibody
The SNX1 antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is widely used in the field of Life Sciences for research purposes. This antibody has the ability to bind to EPO and its receptor, inhibiting their interaction and blocking downstream signaling pathways. The SNX1 antibody can also be used to detect the presence of autoantibodies against EPO in human serum samples. Additionally, it can be utilized in immunoassays to measure EPO levels or to study the binding properties of EPO binding proteins. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying erythropoiesis, growth factors, and related processes.
Caspase 9 antibody
The Caspase 9 antibody is a highly effective tool for research in the field of Life Sciences. This antibody is designed to specifically target and bind to caspase-9, an important protein involved in apoptosis, or programmed cell death. The antibody is conjugated with magnetic particles, which allows for easy isolation and purification of the target protein.
ARG1 antibody
The ARG1 antibody is a highly effective polyclonal antibody that is used in various medical applications. It is available in both colloidal and monoclonal forms, providing versatility for different research needs. This antibody has been extensively studied and proven to be effective in various studies.α Tubulin 3C antibody
alpha Tubulin 3C antibody was raised using the N terminal of TUBA3C corresponding to a region with amino acids VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLAKT2 antibody
The AKT2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets insulin, an essential hormone involved in glucose metabolism. This antibody has been extensively studied and proven to be effective in various research applications.Endostatin antibody
The Endostatin antibody is a highly specialized antibody that targets a specific molecule in the body. It is a disulfide bond-containing antibody that belongs to the class of Antibodies. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.CHRNA1 antibody
CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVSH1 antibody
The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.
PDE4B antibody
PDE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDproBNP antibody
The proBNP antibody is a monoclonal antibody that specifically targets proBNP, an important biomarker for heart failure. This antibody is designed to detect and quantify proBNP levels in human serum samples. It has high specificity and sensitivity, allowing for accurate and reliable measurement of proBNP levels.Neuropilin antibody
The Neuropilin antibody is a monoclonal antibody that targets the neuropilin protein, which plays a crucial role in various cellular processes such as growth factor signaling and collagen formation. This antibody specifically binds to neuropilin and inhibits its interaction with growth factors, including vascular endothelial growth factor-1 receptor (VEGFR-1) and alpha-fetoprotein.GRSF1 antibody
GRSF1 antibody was raised using the N terminal of GRSF1 corresponding to a region with amino acids SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYLPSA antibody
PSA antibody is a hormone peptide that is commonly used in Life Sciences research. It is an essential tool for studying the role of prostate-specific antigen (PSA) in various biological processes. This monoclonal antibody has high affinity and specificity for PSA and can be used for the detection and quantification of PSA in human serum samples. The PSA antibody also has antiviral properties and has been shown to inhibit the activity of interferon, which plays a crucial role in the immune response against viral infections. In addition, this antibody can be immobilized on an electrode surface for use in biosensor applications or as a cytotoxic agent for targeted therapy. Its inhibitory effects on leukemia inhibitory factor make it a promising candidate for the development of novel cancer treatments. With its wide range of applications, the PSA antibody is an invaluable tool for researchers in the field of Life Sciences.NUP43 antibody
NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAISAE1 antibody
The SAE1 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the SAE1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying SAE1 protein levels.
CD104 antibody (Azide Free)
CD104 antibody was raised in rat using tumor-associated antigen TSP-180 immunoaffinity purified from a transplantable BALB/c mouse lung cell carcinoma as the immunogen.
PFKL antibody
The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.
FAM131C antibody
FAM131C antibody was raised using the middle region of FAM131C corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQFACTRT1 antibody
ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
proGRP antibody
The proGRP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and immobilize the proGRP protein, which plays a crucial role in various biological processes. This antibody is produced using both monoclonal and polyclonal antibodies, ensuring high specificity and sensitivity.
CD69 antibody
The CD69 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets CD69, a glycan protein expressed on the surface of activated immune cells. This antibody has neutralizing properties and can block the binding of other molecules to CD69, preventing their activation.
