Primary Antibodies

MDC antibody was raised in rabbit using highly pure recombinant murine MDC as the immunogen.

MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE

Cst6 antibody was raised in rabbit using the middle region of Cst6 as the immunogen

ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT

CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV

NOV antibody was raised in rabbit using highly pure recombinant human NOV as the immunogen.

LIGHT antibody was raised in rabbit using highly pure recombinant human LIGHT as the immunogen.

IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA

LOC731673 antibody was raised in rabbit using the C terminal of LOC731673 as the immunogen

RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG

SLC43A2 antibody was raised using the N terminal of SLC43A2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

CCL16 antibody was raised in rabbit using the N terminal of CCL16 as the immunogen

LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS

The ERK1 antibody is a highly specialized antibody that is used for the detection and analysis of activated ERK1 protein. This antibody has been extensively tested and validated for its specificity and sensitivity in various research applications. It is commonly used in studies involving ginseng, botulinum, histidine protein, and other related fields.

TBL1Y antibody was raised in rabbit using the middle region of TBL1Y as the immunogen

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE

The Tyrosine Hydroxylase antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and detect tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter essential for brain function. This antibody is commonly used in immunoassays to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.

RHOX11 antibody was raised in rabbit using the N terminal of RHOX11 as the immunogen

Purified Polyclonal MKK1/2 antibody

ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL

UBE2D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSIC

C2orf28 antibody was raised in rabbit using the C terminal of C2ORF28 as the immunogen

AKT2 antibody was raised in rabbit using the middle region of AKT2 as the immunogen

SLPI antibody was raised in rabbit using the N terminal of SLPI as the immunogen

FBXL4 antibody was raised in rabbit using the N terminal of FBXL4 as the immunogen

PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

RNF170 antibody was raised using the C terminal of RNF170 corresponding to a region with amino acids FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

CD100 antibody was raised in rabbit using residues 147-158 [GKNEDGKGRCPF] of the human CD100 protein as the immunogen.

ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR

NTF5 antibody was raised using the N terminal Of Ntf5 corresponding to a region with amino acids LAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSE

SLCO2B1 antibody was raised using the N terminal of SLCO2B1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ

HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

ZNF415 antibody was raised in rabbit using the N terminal of ZNF415 as the immunogen

E2f7 antibody was raised in rabbit using the N terminal of E2F7 as the immunogen

HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen

ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA

Slc6a9 antibody was raised in rabbit using the C terminal of Slc6a9 as the immunogen

Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

The CD90 antibody is a highly specialized product in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody has shown remarkable photostability, making it ideal for various experimental settings. It has also been found to interact with interferon and polymerase enzymes, further enhancing its versatility.

TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI

SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE