Primary Antibodies

Akt, also called Protein Kinase B (PKB), is a serine/threonine-specific protein kinase crucial for regulating cellular functions such as growth, survival, metabolism, and proliferation. It serves as a central component in the PI3K/Akt/mTOR pathway, integrating signals required for cellular adaptation and function. Humans express three primary isoforms of Akt—Akt1, Akt2, and Akt3—each encoded by different genes. Activation of Akt starts when external signals, like growth factors or insulin, bind to cell surface receptors, which then activate phosphoinositide 3-kinase (PI3K). This cascade leads to the formation of PIP3 on the cell membrane, recruiting Akt to undergo two key phosphorylation events at Thr308 and Ser473. Once activated, Akt can travel within the cell to phosphorylate target proteins.The main functions of Akt include enhancing cell survival by blocking apoptosis through the inactivation of pro-apoptotic proteins such as BAD and Caspase-9, and promoting cell growth and proliferation by activating mTOR, a critical regulator of protein synthesis. Akt also plays a central role in metabolism, boosting glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, which is especially important in muscle and fat tissues. Additionally, Akt facilitates angiogenesis by upregulating VEGF, supporting tissue repair, and enhances cell migration, assisting in wound healing but also enabling the spread of cancer cells. Given its broad role in supporting cell growth and survival, Akt is frequently hyperactivated in cancers, fueling unchecked cell division and tumor development, which makes it a target in cancer treatments. Furthermore, Akt’s role in glucose metabolism connects it to insulin signaling, where pathway disruptions can lead to impaired glucose uptake, contributing to insulin resistance and type 2 diabetes.

TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids SGGPSSPPSDPPAMSPGPLDALSSPTSVQEADETTRSDISERPSVDDIES

<p>BSG antibody was raised in rabbit using the N terminal of BSG as the immunogen</p>

<p>SLC10A3 antibody was raised in rabbit using the middle region of SLC10A3 as the immunogen</p>

GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

<p>Rabbit IgM antibody was raised in goat using normal rabbit IgM as the immunogen.</p>

UBN1 antibody was raised in rabbit using the C terminal of UBN1 as the immunogen

CHRNA5 antibody was raised in rabbit using the middle region of CHRNA5 as the immunogen

AMACR antibody was raised in rabbit using residues 33-48 [RVDRPGSRYDVSRLGR] of the 42 kDa human AMACR (P504S) protein as the immunogen.

RGD1563533 antibody was raised in rabbit using the middle region of RGD1563533 as the immunogen

PRRG3 antibody was raised using the N terminal of PRRG3 corresponding to a region with amino acids EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL

DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP

QARS antibody was raised in rabbit using the N terminal of QARS as the immunogen

<p>STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL</p>

<p>ZNF101 antibody was raised in rabbit using the N terminal of ZNF101 as the immunogen</p>

<p>RAB35 antibody was raised in rabbit using the middle region of RAB35 as the immunogen</p>

<p>EGLN2 antibody was raised in rabbit using the middle region of EGLN2 as the immunogen</p>

<p>Mouse monoclonal p53 antibody (Prediluted for IHC)</p>

<p>GOLGA1 antibody was raised in rabbit using the N terminal of GOLGA1 as the immunogen</p>

UBE2K antibody was raised in rabbit using the middle region of UBE2K as the immunogen

FEZF1 antibody was raised in rabbit using the C terminal of FEZF1 as the immunogen

<p>P2RX5 antibody was raised using the N terminal of P2RX5 corresponding to a region with amino acids LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR</p>

<p>Nptx1 antibody was raised in rabbit using the middle region of Nptx1 as the immunogen</p>

SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

<p>BACE antibody was raised in goat using highly pure (&gt;98%) recombinant human BAFF as the immunogen.</p>

<p>TIMELESS antibody was raised in rabbit using the N terminal of TIMELESS as the immunogen</p>

ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen

<p>CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV</p>

<p>HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM</p>

<p>RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT</p>

ZNF766 antibody was raised in rabbit using the N terminal of ZNF766 as the immunogen

KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA

FMNL2 antibody was raised in rabbit using the N terminal of FMNL2 as the immunogen

<p>GFPT2 antibody was raised in rabbit using the N terminal of GFPT2 as the immunogen</p>

<p>Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG</p>

Abcb10 antibody was raised in rabbit using the middle region of Abcb10 as the immunogen

<p>ZNF174 antibody was raised in rabbit using the middle region of ZNF174 as the immunogen</p>

<p>Cacng8 antibody was raised in rabbit using the middle region of Cacng8 as the immunogen</p>

The MPL antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets the myeloproliferative leukemia (MPL) receptor, which is a tyrosine kinase receptor involved in the regulation of hematopoiesis. This antibody has been extensively studied and has shown neutralizing activity against MPL ligands such as thrombopoietin, resulting in the inhibition of downstream signaling pathways.

<p>SMYD4 antibody was raised in rabbit using the N terminal of SMYD4 as the immunogen</p>

<p>TIMP2 antibody was raised in rabbit using the N terminal of TIMP2 as the immunogen</p>

GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF

<p>ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK</p>

<p>Complement C1q antibody was raised against Human Complement C1q.</p>

<p>PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL</p>

SLC9A3 antibody was raised in rabbit using the middle region of SLC9A3 as the immunogen

<p>WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA</p>

<p>BBS2 antibody was raised in rabbit using the middle region of BBS2 as the immunogen</p>

<p>TRIP6 antibody was raised in rabbit using the N terminal of TRIP6 as the immunogen</p>

Estrogen receptor beta antibody was raised in rabbit using a synthetic peptide corresponding to residues A(55) E P Q K S P W C E A R S L E H(70) of rat estrogen receptor beta as the immunogen.

MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP

<p>FCER1G antibody was raised in rabbit using the N terminal of FCER1G as the immunogen</p>

CST9 antibody was raised in rabbit using the middle region of CST9 as the immunogen

<p>SNAG1 antibody was raised in rabbit using the C terminal of SNAG1 as the immunogen</p>

<p>SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF</p>

ZNF578 antibody was raised in rabbit using the N terminal of ZNF578 as the immunogen

Purified Polyclonal HSPA14 antibody

<p>Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF</p>

GALE antibody was raised in rabbit using the middle region of GALE as the immunogen

<p>ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA</p>

<p>GPSN2 antibody was raised using the C terminal of GPSN2 corresponding to a region with amino acids LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV</p>

CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG

Zfp161 antibody was raised in rabbit using the middle region of Zfp161 as the immunogen

<p>NPTX2 antibody was raised in rabbit using the N terminal of NPTX2 as the immunogen</p>

<p>Purified Polyclonal ACC alpha antibody</p>

<p>TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS</p>

<p>CD100 antibody was raised in rabbit using residues 777-788 [KPKSDFCDREQS] of the human CD100 protein as the immunogen.</p>

<p>MCM8 antibody was raised using the C terminal of MCM8 corresponding to a region with amino acids IRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQH</p>

<p>SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV</p>

MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

<p>ZNF334 antibody was raised in rabbit using the N terminal of ZNF334 as the immunogen</p>

ZDHHC24 antibody was raised using the middle region of ZDHHC24 corresponding to a region with amino acids QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA

ZBTB3 antibody was raised in rabbit using the middle region of ZBTB3 as the immunogen

SERPINB10 antibody was raised in rabbit using residues 316-330 [SQSKADFSGMSSARN] of the human SERPINB10 protein as the immunogen.

SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen

Hey1 antibody was raised in rabbit using the C terminal of Hey1 as the immunogen

<p>PHF23 antibody was raised in rabbit using the N terminal of PHF23 as the immunogen</p>

<p>Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG</p>

<p>MRS2L antibody was raised using the middle region of Mrs2L corresponding to a region with amino acids  LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL</p>

TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATVVYLV

<p>SHPRH antibody was raised in rabbit using residues 515-535 (DKTKKQAVGSPRKIEKELRKS) of the mouse SHPRH protein as the immunogen.</p>

ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogen

<p>The Midkine antibody is a powerful tool in Life Sciences research. Midkine is a growth factor that plays a crucial role in various biological processes, including cell proliferation, migration, and survival. It interacts with TGF-β1 and other binding proteins to regulate the activity of the erythropoietin receptor.</p>

<p>LOC652119 antibody was raised in rabbit using the C terminal of LOC652119 as the immunogen</p>

Slc9a7 antibody was raised in rabbit using the C terminal of Slc9a7 as the immunogen

<p>C1ORF25 antibody was raised in rabbit using the N terminal of C1ORF25 as the immunogen</p>

PAXIP1 antibody was raised in rabbit using the N terminal of PAXIP1 as the immunogen

<p>KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP</p>

<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>

<p>COMMD8 antibody was raised in rabbit using the middle region of COMMD8 as the immunogen</p>

TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

<p>TRIM58 antibody was raised in rabbit using the middle region of TRIM58 as the immunogen</p>

ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogen

C1 Inhibitor antibody was raised against Human C1 Inhibitor.

<p>DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD</p>

Ela1 antibody was raised in rabbit using the middle region of Ela1 as the immunogen

PTGES3 antibody was raised in rabbit using the middle region of PTGES3 as the immunogen

<p>CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV</p>

<p>Purified Polyclonal ANKRD20A3 antibody</p>

<p>ETHE1 antibody was raised in rabbit using the middle region of ETHE1 as the immunogen</p>

LOC641765 antibody was raised in rabbit using the C terminal of LOC641765 as the immunogen

LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE

<p>NOSIP antibody was raised in rabbit using the middle region of NOSIP as the immunogen</p>

ZNF205 antibody was raised in rabbit using the middle region of ZNF205 as the immunogen

ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

<p>ZNF547 antibody was raised in rabbit using the N terminal of ZNF547 as the immunogen</p>

KLK-L4 antibody was raised in rabbit using residues 262-277 [IRKYETQQQKWLKGPQ] of the human KLK-L4 protein as the immunogen.

CHIA antibody was raised using the middle region of CHIA corresponding to a region with amino acids GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP

<p>MAP1 antibody was raised in rabbit using residues 337-351 EEEALLQAILEGNFT of the human MAP-1 protein as the immunogen.</p>

Calreticulin antibody is a specific antibody that targets calreticulin, a protein found in human serum. Calreticulin plays a crucial role in various cellular processes, including protein folding and quality control. This antibody can be used for protein kinase assays, as well as for detecting calreticulin expression levels in different tissues using techniques like immunohistochemistry or Western blotting.

APRIL antibody was raised in rabbit using highly pure recombinant human APRIL as the immunogen.

<p>RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF</p>

<p>Rbm15b antibody was raised in rabbit using the C terminal of Rbm15b as the immunogen</p>

GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS

<p>LIN9 antibody was raised in rabbit using the N terminal of LIN9 as the immunogen</p>

Shkbp1 antibody was raised in rabbit using the N terminal of Shkbp1 as the immunogen

<p>SRFBP1 antibody was raised in rabbit using the middle region of SRFBP1 as the immunogen</p>

<p>FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK</p>

<p>ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR</p>

CHST8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST

<p>MYL4 antibody was raised in rabbit using the N terminal of MYL4 as the immunogen</p>

TXNDC13 antibody was raised using the C terminal of TXNDC13 corresponding to a region with amino acids PGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL

PPHLN1 antibody was raised in rabbit using the N terminal of PPHLN1 as the immunogen

LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH

<p>ADORA2A antibody was raised in rabbit using the N terminal of ADORA2A as the immunogen</p>

<p>ZNF254 antibody was raised in rabbit using the middle region of ZNF254 as the immunogen</p>

<p>ZNF501 antibody was raised in rabbit using the C terminal of ZNF501 as the immunogen</p>

Stat5b antibody was raised in rabbit using the c terminal of Stat5b as the immunogen

<p>The STAT5 antibody is a polyclonal antibody that specifically targets the STAT5 protein. STAT5 is a transcription factor that plays a crucial role in various cellular processes, including cell proliferation, differentiation, and survival. This antibody can be used in immunoassays to detect and quantify the expression of STAT5 in different samples.</p>

The Cortactin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the cortactin protein, which plays a crucial role in cell migration and invasion. This antibody can be used to study various cellular processes, including annexin-mediated endocytosis, lipoprotein lipase activity regulation, and fibrinogen binding. Additionally, it has been found to interact with TGF-beta signaling pathways and phosphatase activity.

<p>USP10 antibody was raised in rabbit using the middle region of USP10 as the immunogen</p>

<p>Purified Polyclonal AKAP5 antibody</p>

SLC22A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

<p>OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA</p>

<p>Rabbit polyclonal Thyroglobulin antibody (Prediluted for IHC)</p>

<p>Rabbit polyclonal Vimmentin antibody (Prediluted for IHC)</p>

<p>INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ</p>

Hoxd13 antibody was raised in rabbit using the C terminal of Hoxd13 as the immunogen

Hemopexin antibody was raised against Human Hemopexin.

<p>KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW</p>

SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

<p>PAIP2 antibody was raised in rabbit using the N terminal of PAIP2 as the immunogen</p>

<p>Cnih antibody was raised in rabbit using the N terminal of Cnih as the immunogen</p>

Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

PSMF1 antibody was raised in rabbit using the middle region of PSMF1 as the immunogen

GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP

<p>ZMIZ1 antibody was raised in rabbit using the N terminal of ZMIZ1 as the immunogen</p>

Purified Polyclonal EEF1G antibody

<p>ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE</p>

<p>ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA</p>

<p>STARD8 antibody was raised in rabbit using the N terminal of STARD8 as the immunogen</p>

<p>CUX2 antibody was raised in rabbit using the N terminal of CUX2 as the immunogen</p>

CRTR1 antibody was raised in rabbit using residues 1-16 MLFWHTQPEHYNQHNS and 464-479 TLKAESSDGYHIILKC of the CRTR-1 protein as the immunogen.

<p>The CDC25C antibody is a polyclonal antibody that specifically targets the growth factor CDC25C. It is known to play a crucial role in cell cycle regulation and is primarily located on the apical membrane of cells. The CDC25C antibody can be used in various assays and experiments to detect and measure the levels of CDC25C protein. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The CDC25C antibody has been widely used in studies related to hepatocyte growth, epidermal growth, human folate metabolism, collagen activation, and glycosylation processes. Additionally, it has been employed as an inhibitor of phosphatase activity in different experimental settings. With its high specificity and reliability, the CDC25C antibody is an essential tool for researchers studying cell cycle regulation and related pathways.</p>

<p>PCDHB16 antibody was raised in rabbit using the middle region of PCDHB16 as the immunogen</p>

<p>SERPINB2 antibody was raised in rabbit using the middle region of SERPINB2 as the immunogen</p>

NRG1 antibody was raised using the middle region of NRG1 corresponding to a region with amino acids SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV

<p>VMAT2 antibody was raised in rabbit using Internal sequence of the human, mouse and rat VMAT2 protein as the immunogen.</p>

ETV3L antibody was raised in rabbit using the C terminal of ETV3L as the immunogen

<p>UBXN6 antibody was raised in rabbit using the C terminal of UBXN6 as the immunogen</p>

<p>GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM</p>

<p>Cyclin E2 antibody was raised in rabbit using residues 2-15 [SRRSSRLQAKQQPQC] of the Cyclin E2 protein as the immunogen.</p>

<p>Snf8 antibody was raised in rabbit using the N terminal of Snf8 as the immunogen</p>

Mouse monoclonal BRDU antibody (Prediluted for IHC)

PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

<p>LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR</p>

ZNF474 antibody was raised in rabbit using the N terminal of ZNF474 as the immunogen

<p>Tgfb3 antibody was raised in rabbit using the middle region of Tgfb3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth. With its potent properties and mechanisms of action, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside offers a promising solution for combating tuberculosis infections.</p>

LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

<p>CD8A antibody was raised in rabbit using the middle region of CD8A as the immunogen</p>

<p>Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen</p>