Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Lamin A Antibody
<p>The Lamin A Antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that is specifically designed to target and bind to Lamin A, an important protein involved in various cellular processes. This antibody is widely used in research and diagnostic applications.</p>ENOSF1 antibody
<p>ENOSF1 antibody was raised using the N terminal of ENOSF1 corresponding to a region with amino acids MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK</p>AGK antibody
<p>AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE</p>CD166 antibody
<p>CD166 antibody was raised in mouse using human thymic epithelial cells as the immunogen.</p>GIPC2 antibody
<p>GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH</p>CD69 antibody
<p>The CD69 antibody is a monoclonal antibody that specifically targets the CD69 antigen, which is expressed on activated cells. This antibody is commonly used in life sciences research to study immune responses and cell activation. It has been shown to be effective in blocking the function of CD69, making it a valuable tool for investigating the role of this antigen in various biological processes. Additionally, the CD69 antibody has been used in studies related to antiestrogen therapy, as it has been found to interact with other proteins such as cystatin and fatty acid-binding protein. Its high specificity and low viscosity make it an ideal choice for experiments involving human serum or other complex biological samples.</p>FFAR1 antibody
<p>FFAR1 antibody was raised in rabbit using the N terminal of FFAR1 as the immunogen</p>PSF3 antibody
<p>PSF3 antibody was raised in mice which were immunized with murine PSF3. Mouse spleen cells were isolated and fused with mouse melanoma in order to establish hybridoma cells.</p>PPM1B antibody
<p>The PPM1B antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to annexin, a human protein involved in various cellular processes. This antibody has been extensively tested and validated for its efficacy in immunoassays and other research applications.</p>HIVEP2 antibody
HIVEP2 antibody was raised in mouse using recombinant Human Human Immunodeficiency Virus Type I Enhancer Binding Protein 2 (Hivep2)CRADD antibody
The CRADD antibody is a monoclonal antibody that specifically targets the CRADD protein. This protein plays a crucial role in various biological processes, including cell growth, apoptosis, and insulin signaling. The CRADD antibody has been extensively studied in the field of life sciences and has shown promising results in research related to adipocytes, growth factors, and insulin.ROCK1 antibody
The ROCK1 antibody is a highly effective inhibitor of the Rho-associated protein kinase 1 (ROCK1), which plays a crucial role in various cellular processes. This monoclonal antibody specifically targets ROCK1 and prevents its activation, leading to the inhibition of downstream signaling pathways involved in cell migration, proliferation, and contraction.DDX50 antibody
DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGCystatin 8 antibody
<p>Cystatin 8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY</p>MBD2 antibody
<p>MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT</p>Flag Tag antibody
<p>The Flag Tag antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is designed to specifically target and bind to the Flag epitope, which is a small peptide sequence commonly added to proteins for detection and purification purposes. This antibody has been extensively validated for use in various applications such as immunoassays, Western blotting, immunofluorescence, and flow cytometry. One of the key advantages of the Flag Tag antibody is its high affinity and specificity towards the Flag epitope. This ensures reliable and accurate detection of proteins carrying this tag. Additionally, the antibody exhibits minimal cross-reactivity with other commonly used tags, making it an ideal choice for researchers working with multiple protein expression systems. In addition to its exceptional performance in protein detection, the Flag Tag antibody also offers excellent stability and reproducibility. It can withstand harsh experimental conditions such as high temperatures or denaturing agents without compromising its binding efficiency. This makes it suitable for a wide range</p>GATAD1 antibody
GATAD1 antibody was raised in mouse using recombinant Gata Zinc Finger Domain Containing 1 (Gatad1)STEAP4 antibody
<p>The STEAP4 antibody is a monoclonal antibody that targets and inhibits the activity of STEAP4, a protein involved in various cellular processes. This antibody has been shown to be effective in blocking the function of STEAP4, making it a potential therapeutic option for conditions related to its overexpression or dysregulation.</p>Claudin 1 antibody
<p>The Claudin 1 antibody is a therapeutically valuable monoclonal antibody that acts as an inhibitor of kinases. It is widely used in the field of Life Sciences for its antiviral properties. This antibody targets and inhibits specific kinases, which are enzymes that play a crucial role in various cellular processes. By inhibiting these kinases, the Claudin 1 antibody can effectively block viral replication and prevent the spread of infections.</p>TRIM2 antibody
<p>The TRIM2 antibody is a monoclonal antibody that specifically targets epidermal growth factor (EGF). It is highly effective in detecting and quantifying EGF levels in various biological samples. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for research in the field of life sciences.</p>ACSM3 antibody
<p>ACSM3 antibody was raised in rabbit using the N terminal of ACSM3 as the immunogen</p>Calpastatin antibody
Calpastatin antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-Calpastatin as the immunogen.CPA1 antibody
The CPA1 antibody is an inhibitor that targets the epidermal growth factor receptor (HER2). It is a monoclonal antibody that specifically binds to HER2, preventing its activation and signaling cascade. This antibody has been used in anti-HER2 antibody-drug conjugates, where it is conjugated with a cytotoxic drug to selectively deliver the drug to HER2-positive cancer cells. The CPA1 antibody has shown promising results in preclinical studies, inhibiting tumor growth and improving overall survival. Additionally, this antibody has been investigated for its potential therapeutic effects in other diseases such as fatty acid metabolism disorders, tyrosine kinase-driven cancers, c-myc overexpression, and alpha-synuclein aggregation associated with neurodegenerative diseases. With its wide range of applications in life sciences research and potential therapeutic use, the CPA1 antibody holds great promise in advancing our understanding and treatment of various conditions related to epidermal growth factor signaling.BMPR2 antibody
<p>The BMPR2 antibody is a polyclonal antibody that specifically targets the bone morphogenetic protein receptor 2 (BMPR2). This receptor plays a crucial role in various cellular processes, including cell growth, differentiation, and development. The BMPR2 antibody can be used in various life science research applications to study the function and regulation of this receptor.</p>CD23 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, which effectively prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.RSPH10B antibody
<p>RSPH10B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN</p>RIPK1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. Extensive research has demonstrated its high efficacy in human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at elevated levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>DNASE2B antibody
<p>DNASE2B antibody was raised using the C terminal of DNASE2B corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD</p>GLUT1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing bacterial growth. Extensive research has been conducted on this drug using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>SNX4 antibody
<p>The SNX4 antibody is a polyclonal antibody that is widely used in Life Sciences research. It plays a crucial role in various cellular processes, including the regulation of ornithine and the transport of multidrug resistance proteins. This antibody has been extensively studied for its ability to neutralize the activity of growth factors and inhibitors, such as ketamine, transferrin, low-molecular-weight compounds, interferon, collagen, and epidermal growth factor. Its high specificity and affinity make it an ideal tool for studying the function of these molecules in different biological systems. Additionally, the SNX4 antibody can be used in techniques such as immunohistochemistry and Western blotting to detect and quantify the expression levels of target proteins. With its excellent performance and reliability, this antibody is a valuable asset for researchers in various fields.</p>Norovirus G2 antibody
Norovirus G2 antibody is a monoclonal antibody that specifically targets the G2 strain of norovirus. It is derived from human serum and has been shown to form dimers, which enhance its binding affinity and effectiveness. This antibody works by immobilizing the virus, preventing it from infecting host cells and causing illness. Norovirus G2 antibody is widely used in Life Sciences research for studying the virus and developing diagnostic tools. It can be used in various applications, such as immunoassays, Western blotting, and immunohistochemistry. This antibody has also shown potential therapeutic applications in the treatment of norovirus infections.FSHR antibody
<p>The FSHR antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both monoclonal and polyclonal antibodies. This antibody is colloidal in nature, making it easy to work with in laboratory settings. It has been extensively used for research purposes, particularly in the study of mesenchymal stem cells.</p>Lamin B2 antibody
The Lamin B2 antibody is a powerful tool in the field of Life Sciences. This Monoclonal Antibody specifically targets and binds to Lamin B2, a protein involved in nuclear envelope structure and stability. By using this antibody, researchers can study the role of Lamin B2 in various cellular processes.Cyclin A1 antibody
<p>The Cyclin A1 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to Cyclin A1, a protein involved in cell cycle regulation and growth factor signaling. This antibody has been extensively validated for use in various applications, including immunofluorescence, immunohistochemistry, and Western blotting.</p>CDKN1B antibody
<p>CDKN1B antibody was raised in rabbit using the C terminal of CDKN1B as the immunogen</p>Cytokeratin 17 antibody
<p>Cytokeratin 17 antibody is a monoclonal antibody that specifically targets hepatocyte growth factor. It is used in various research and diagnostic applications in the field of life sciences. This antibody binds to c-myc, a protein involved in cell proliferation and differentiation, and epidermal growth factor receptor (EGFR), which plays a crucial role in cell signaling pathways. Cytokeratin 17 antibody has been shown to be effective in detecting the presence of autoantibodies and histidine residues in biological samples. Additionally, it can be used to study the role of leukemia inhibitory factor (LIF) and other growth factors in cellular processes. With its high specificity and sensitivity, this antibody is an invaluable tool for scientists and researchers working in the field of life sciences.</p>TET2 antibody
The TET2 antibody is an immunosuppressive reagent that specifically targets 5-hydroxymethylcytosine (5hmC). It belongs to the class of polyclonal antibodies and is widely used in Life Sciences research. This antibody has been shown to effectively inhibit the activity of TET2, an enzyme involved in DNA demethylation. By blocking TET2, this antibody can modulate gene expression and epigenetic regulation. Researchers can use the TET2 antibody as a valuable tool for studying DNA methylation dynamics and exploring its role in various biological processes. With its high specificity and reliability, this antibody is an essential component of any laboratory focused on epigenetics research.POLR1D antibody
<p>POLR1D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF</p>Dynamitin antibody
<p>The Dynamitin antibody is a powerful tool used in Life Sciences research for studying molecular signaling and protein complexes. It can be used in mass spectrometric methods to identify and analyze activated pathways in cells. This antibody is specifically designed to target Dynamitin, a protein involved in various cellular processes. It has been shown to bind to Dynamitin with high specificity and sensitivity, making it an excellent test substance for experiments.</p>CXCL5 antibody
The CXCL5 antibody is a growth factor that targets the epidermal growth factor receptor (EGFR). It is an inhibitor that works by blocking the binding of growth factors to EGFR, preventing downstream signaling and inhibiting cell proliferation. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research studies. It specifically targets tyrosine kinase receptors involved in cell growth and differentiation, making it a valuable tool for studying cellular processes. The CXCL5 antibody is available in both polyclonal and monoclonal forms, providing researchers with options depending on their specific needs. With its high specificity and affinity, this antibody is widely used in studies involving insulin-like growth factor-1 receptor (IGF-1R) signaling, actin filaments, and other related pathways. Researchers can rely on the CXCL5 antibody to provide accurate and reliable results for their experiments.CK1 antibody
CK1 antibody was raised in Mouse using a purified recombinant fragment of CK1 expressed in E. coli as the immunogen.RNF6 antibody
RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQQRLDGVKEQLASQPDLRDGTNYRDSEVPRESSHEDSLLEWLNTFRRTGSERBP1 antibody
<p>SERBP1 antibody was raised using the middle region of SERBP1 corresponding to a region with amino acids SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE</p>PDPN antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes.</p>DNMT3B antibody
<p>The DNMT3B antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of DNMT3B, an enzyme involved in DNA methylation. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. Additionally, the DNMT3B antibody has been found to be nephrotoxic, affecting the kidneys' function. It interacts with endogenous hematopoietic cells and can bind to various proteins in human serum, including albumin and fibrinogen. The DNMT3B antibody is commonly used in life sciences research, particularly in studies related to insulin regulation and activation pathways. Whether you're looking to explore the role of DNMT3B in disease progression or investigate potential therapeutic interventions, this high-quality monoclonal antibody is an invaluable tool for your research endeavors.</p>FPR1 antibody
<p>The FPR1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is designed to neutralize specific chemokines. This antibody is widely used in research and laboratory settings for its ability to target and bind to FPR1 receptors.</p>HDAC4 antibody
HDAC4 antibody was raised in Mouse using a purified recombinant fragment of human HDAC4 expressed in E. coli as the immunogen.PPID antibody
<p>PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN</p>TAFI antibody (HRP)
TAFI antibody (HRP) was raised in sheep using human TAFI purified from plasma as the immunogen.Myc antibody
<p>The Myc antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the Myc protein, which plays a crucial role in cell growth and proliferation. This antibody has been extensively studied and proven to be highly effective in various applications.</p>Rat Thrombocyte antibody (FITC)
<p>Rat thrombocyte antibody (FITC) was raised in rabbit using rat thrombocytes as the immunogen.</p>HSPA4L antibody
<p>HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI</p>RFC2 antibody
<p>The RFC2 antibody is a chimeric protein that belongs to the family of antibodies. It is commonly used in life sciences research for various applications such as immunohistochemistry, Western blotting, and ELISA. This antibody specifically targets RFC2, a protein involved in DNA replication and repair processes. By binding to RFC2, the antibody allows for the detection and analysis of this protein in different biological samples.</p>ATF2 antibody
<p>The ATF2 antibody is a highly specialized monoclonal antibody that targets the alpha-fetoprotein (AFP) and amyloid protein. It is activated by a DNA vaccine and has been extensively tested in human serum samples. This antibody specifically binds to ATF2, a transcription factor that plays a critical role in cell survival and proliferation. The ATF2 antibody can be used for ultrasensitive detection of AFP and amyloid protein in various bioassays. Its high specificity and sensitivity make it an ideal tool for researchers studying the role of these proteins in disease development and progression. Additionally, this antibody can be used in phosphatase-linked immunoassays or carbon electrode-based assays for genotoxicity testing. With its versatile applications, the ATF2 antibody is a valuable asset for any laboratory conducting research in these fields.</p>SYK antibody
The SYK antibody is a highly effective polyclonal antibody that is used for various applications. It can be used in research and diagnostic settings to detect and measure the presence of specific proteins or biomarkers. The SYK antibody works by binding to its target protein, sclerostin, which plays a crucial role in bone metabolism. By targeting sclerostin, the SYK antibody helps to inhibit its function and promote bone formation.FAM50B antibody
<p>FAM50B antibody was raised using the N terminal of FAM50B corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD</p>SAMHD1 antibody
<p>The SAMHD1 antibody is a highly specialized monoclonal antibody that specifically targets the SAMHD1 protein. This protein plays a crucial role in regulating the cellular dNTP pool, which is essential for DNA replication and repair. By binding to SAMHD1, this antibody can effectively inhibit its function and disrupt the normal cell cycle.</p>p53 antibody
<p>The p53 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively studied and proven to be effective in various applications.</p>FKBP52 antibody
<p>The FKBP52 antibody is a highly specialized monoclonal antibody that has the ability to neutralize the effects of angptl3, a growth factor involved in adipose tissue regulation. This antibody can be used in various life sciences applications, such as research and diagnostics. It specifically targets FK506-binding protein 52 (FKBP52), which plays a crucial role in modulating protein phosphatase activity. The FKBP52 antibody can effectively inhibit the interaction between FKBP52 and its target proteins, thereby preventing downstream signaling events. It has been extensively tested and validated for use in various experimental settings, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays. With its high specificity and affinity for FKBP52, this antibody is an essential tool for researchers studying the complex mechanisms underlying cellular processes related to adipose tissue regulation and growth factor signaling pathways.</p>SCN8A antibody
<p>SCN8A antibody was raised using the middle region of SCN8A corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC</p>CDCA7L antibody
<p>CDCA7L antibody was raised using the middle region of CDCA7L corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED</p>L1CAM antibody
The L1CAM antibody is a monoclonal antibody that specifically targets the L1 cell adhesion molecule (L1CAM), a protein expressed in various tissues. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as an inhibitor of L1CAM-mediated growth factor signaling pathways. It has been used in assays to study the activation of L1CAM and its role in various cellular processes. The L1CAM antibody has also demonstrated cytotoxic activity against cells expressing high levels of L1CAM, making it a potential therapeutic option for certain types of cancer. Additionally, this antibody has been found to have vasoactive properties, potentially affecting vascular function. With its ability to target L1CAM and its diverse range of applications, the L1CAM antibody holds great potential for further research and development in the field of biomedicine.ADCK3 antibody
<p>The ADCK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the CD33 protein, as well as VEGF (vascular endothelial growth factor). This antibody has shown promising results in inhibiting the growth of various cancer cells, including MCF-7 breast cancer cells. Additionally, it has been found to have cytotoxic effects on mesenchymal stem cells and can neutralize the activity of circumsporozoite protein, which is involved in malaria infection. The ADCK3 antibody also exhibits properties similar to trastuzumab and adalimumab, acting as a family kinase inhibitor and a potent anti-inflammatory agent. Its versatility and effectiveness make it a valuable tool for researchers in the field of Life Sciences.</p>CD74 antibody
<p>The CD74 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to the CD74 protein, which plays a crucial role in immune responses. This antibody has been shown to inhibit the production of reactive oxygen species and interferon, making it a valuable tool for studying immune system regulation. Additionally, the CD74 antibody can be used to detect autoantibodies and analyze their interactions with cellular components. With its high affinity and specificity, this antibody provides reliable results in various applications such as immunohistochemistry, flow cytometry, and Western blotting. Researchers can trust the CD74 antibody to deliver accurate and reproducible results in their experiments.</p>SAMHD1 antibody
The SAMHD1 antibody is a monoclonal antibody that targets the SAMHD1 protein. SAMHD1 is a glycoprotein that plays a crucial role in cell growth and proliferation. It acts as a binding protein for various growth factors, chemokines, and interferons, regulating their activity and signaling pathways.Neuropsin antibody
<p>The Neuropsin antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets and neutralizes the activity of Neuropsin, an enzyme involved in various physiological processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the areas of ophthalmology and neurology.</p>HP1BP3 antibody
<p>HP1BP3 antibody was raised using the N terminal of HP1BP3 corresponding to a region with amino acids SEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKD</p>FAM113A antibody
<p>FAM113A antibody was raised using the N terminal of FAM113A corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC</p>NAPE-PLD antibody
<p>NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV</p>RAB3IL1 antibody
<p>RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITA</p>PP2Calpha antibody
<p>PP2Calpha antibody was raised in mouse using recombinant human PP2Calpha (1-382aa) purified from E. coli as the immunogen.</p>MCP1 antibody
MCP1 antibody was raised in Mouse using a purified recombinant fragment of human MCP-1 expressed in E. coli as the immunogen.CD248 antibody
<p>The CD248 antibody is a monoclonal antibody that specifically targets and binds to the CD248 protein. This protein is also known as endosialin or tumor endothelial marker 1 (TEM1). CD248 is activated by calpain and taxol inhibitors, and it plays a crucial role in various biological processes, including cell adhesion, migration, and angiogenesis.</p>LRRC42 antibody
<p>LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR</p>UBE2L3 antibody
The UBE2L3 antibody is a powerful tool in the field of Life Sciences. It has been extensively studied for its antifibrotic properties and its role in acid-induced autophagy. This specific antibody targets UBE2L3, a protein involved in various cellular processes. By binding to UBE2L3, the antibody can disrupt protein complex formation and inhibit serine protease activity.IFN gamma antibody
<p>IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.</p>Influenza A antibody (FITC)
Influenza A antibody (FITC) was raised in mouse using Influenza A-from A/Texas strain as the immunogen.PFKP antibody
<p>The PFKP antibody is a specific antibody used in Life Sciences research. It is designed to target and detect the presence of the PFKP protein, a polymorphic glycoprotein involved in syncytia formation. This antibody can be used in various applications such as immunoblotting, immunohistochemistry, and flow cytometry. The PFKP antibody has been validated for use with human serum samples and has shown high specificity and sensitivity. It can be used in conjunction with lectins or other glycan-binding proteins for further analysis. This monoclonal antibody is available as magnetic particles conjugated with the PFKP-specific antibody, allowing for easy separation and purification of target molecules. With its high affinity and specificity, this PFKP antibody is an essential tool for researchers studying the function and regulation of this important protein in various biological systems.</p>ApoER2 antibody
<p>The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.</p>DCK antibody
<p>The DCK antibody is a monoclonal antibody that is activated and functions as a globulin. It possesses antiviral properties and acts as a natriuretic agent. This antibody is widely used in the field of Life Sciences for various applications, including neutralizing specific targets and serving as a family kinase inhibitor. Additionally, it has been found to have immobilization properties when used in conjunction with excipients. The DCK antibody can be utilized in research settings, such as in vitro studies involving human serum or electrode-based experiments. Its versatility makes it an essential tool for scientists and researchers in various fields.</p>CD79b antibody (Azide Free)
<p>CD79b antibody was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.</p>JAK2 antibody
<p>The JAK2 antibody is a glycoprotein that acts as a multidrug inhibitor. It specifically targets the p38 mitogen-activated protein, which plays a crucial role in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an effective tool for studying protein kinases and their functions.</p>DNAJB6 antibody
DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDSKIDINS220 antibody
<p>KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen</p>
