Primary Antibodies

<p>The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.</p>

Rabbit polyclonal AFX antibody

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

Rabbit anti-human IgG was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.

Rabbit anti-sheep IgG (HRP) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

Goat anti-rat IgM (HRP) was raised in goat using rat IgM mu chain as the immunogen.

<p>The FAK antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets focal adhesion kinase (FAK), a protein involved in cellular signaling and cytoskeletal structure. This antibody can be used to study the role of FAK in various cellular processes, including cell migration, proliferation, and survival.</p>

<p>basic hair keratin K81 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K81 coupled to KLH as the immunogen.</p>

Goat anti-mouse IgM was raised in goat using murine IgM mu heavy chain as the immunogen.

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

Donkey anti-rabbit IgG (H+L) (HRP) was raised in donkey using rabbit IgG whole molecule as the immunogen.

<p>PDE1C antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

Goat anti-rabbit IgG (H+L) was raised in goat using rabbit IgG whole molecule as the immunogen.

PDE8A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>The VASP antibody is a powerful inhibitor that is widely used in the field of Life Sciences. It specifically targets mir-26a, a non-coding RNA molecule that plays a crucial role in various cellular processes. The VASP antibody is produced by hybridoma cells and is available as a monoclonal antibody.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

The Keratin 18 antibody is a highly specialized monoclonal antibody that targets the TNF-α molecule. It has neutralizing properties and can effectively block the harmful effects of TNF-α in various autoimmune conditions. This antibody is particularly effective when used in combination with other treatments such as adalimumab.

<p>The Chk1 antibody is a powerful tool in the field of molecular biology and research. This antibody specifically targets and binds to the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. By inhibiting the activity of Chk1, this antibody can be used to study the effects of Chk1 inhibition on various cellular processes.</p>

This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

WNK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>PDE5A Antibody</p>

<p>Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>

The VEGFR2 antibody is a highly reactive monoclonal antibody that specifically targets vascular endothelial growth factor receptor 2 (VEGFR2). It is commonly used in research and diagnostic applications in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.

<p>Rabbit anti-human IgG (H+L) was raised in rabbit using human IgG whole molecule as the immunogen.</p>

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

<p>Goat anti-rabbit IgG (H+L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD</p>

<p>PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Paxillin antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including cell adhesion, migration, and signaling. This antibody specifically targets paxillin, an important protein involved in the regulation of cell growth and movement.</p>

Rabbit anti goat IgG (H + L) (agarose conjugated) was raised in rabbit using goat IgG whole molecule as the immunogen.

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

TOB1 antibody was raised in rabbit using the middle region of TOB1 as the immunogen

Goat anti-mouse IgG (H+L) (Fab'2) (HRP) was raised in goat using murine IgG whole molecule as the immunogen.

<p>Rabbit polyclonal FBXL3 antibody</p>

<p>PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Rabbit polyclonal CPI17 alpha antibody</p>

<p>alpha 2 Macroglobulin antibody was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.</p>

<p>The SHP1 antibody is a powerful tool used in the field of life sciences. It belongs to the category of multidrug antibodies and has been extensively studied for its role in various biological processes. This antibody specifically targets androgen, collagen, interferon, hepatocyte growth factor, chemokines, growth factors, and inhibitors.</p>

The SMAD1 antibody is a monoclonal antibody that targets the growth factor trastuzumab. This antibody specifically binds to the SMAD1 protein, which is involved in cell signaling pathways related to fibronectin and acidic environments. By binding to SMAD1, this antibody can inhibit its function and disrupt cellular processes that rely on its activity.

<p>Rabbit anti-bovine IgG (FITC) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>

<p>Sheep polyclonal Kebuzone antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

Purified Rat anti Human lambda light chain antibody

<p>NR4A1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

DPP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>Rabbit anti-goat IgG (FITC) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

ZNF497 antibody was raised in rabbit using the N terminal of ZNF497 as the immunogen

<p>PYGB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

The ERBB3 antibody is a monoclonal antibody that specifically targets the ERBB3 receptor. This receptor plays a crucial role in cell growth and survival pathways, making it an important target for therapeutic interventions. The ERBB3 antibody works by binding to the ERBB3 receptor and inhibiting its activity, thereby preventing the activation of downstream signaling pathways.

Hepatitis C antibody was raised in rabbit using residues 9-21 [CRKTKRNTNRRPQD] of HCV-C1 as the immunogen.

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

Flumequine antibody is a neutralizing antibody that is widely used in Life Sciences research. It specifically targets tissue transglutaminase, which plays a key role in the formation of amyloid plaques. This antibody has been extensively studied and validated for its ability to detect tissue transglutaminase in human serum samples. Flumequine antibody belongs to the class of polyclonal antibodies, which are derived from multiple clones of B cells and can recognize multiple epitopes on an antigen. It is commonly used in various immunoassays and Western blotting applications. Additionally, this antibody has shown potential as a therapeutic agent for targeting membrane-spanning polypeptides and other cell surface antigens. Its unique properties make it an essential tool for researchers studying natriuretic peptides, such as brain natriuretic peptide, and exploring antibody-drug conjugates for targeted therapy.

Goat anti Rabbit IgG (H + L) (rhodamine) secondary antibody; FC 1:50-1:200; IF 1:1000-1:10000

Goat anti-armenian hamster IgG (H + L) (HRP) was raised in goat using hamster IgG (H & L) as the immunogen.

<p>Goat anti-cat IgG (Rhodamine) was raised in goat using feline IgG F(c) fragment as the immunogen.</p>

<p>IRX3 antibody was raised in rabbit using the N terminal of IRX3 as the immunogen</p>

This antibody reacts with heavy chains on human IgE (epsilon chain).

<p>Keratin K28 antibody was raised in Guinea Pig using synthetic peptide of human keratin K28 coupled to KLH as the immunogen.</p>

The Paxillin antibody is a biomolecule that acts as an inhibitor of pro-inflammatory activity. It is a polyclonal antibody that can be used for enzyme-linked immunity detection, surface plasma resonance, and electrode assays. This antibody specifically targets paxillin, a protein involved in cell adhesion and actin filament organization. By binding to paxillin, the antibody disrupts its function and prevents signaling pathways that promote inflammation. The Paxillin antibody is available in both monoclonal and colloidal forms, allowing for versatile use in various experimental setups. It has been extensively validated and is widely used in Life Sciences research and applications.

<p>Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The eIF4E antibody is a highly specialized monoclonal antibody that targets the eukaryotic translation initiation factor 4E (eIF4E). This protein plays a crucial role in the regulation of gene expression and protein synthesis. The eIF4E antibody has been extensively studied for its ability to inhibit the activity of eIF4E, thereby disrupting the translation of specific mRNA molecules.</p>

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

<p>GPR115 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The ICAM1 antibody is a monoclonal antibody that specifically targets the glycoprotein ICAM1. This glycoprotein plays a crucial role in cell adhesion and is involved in various cellular processes, including immune responses and inflammation. The ICAM1 antibody binds to ICAM1, preventing its interaction with other molecules and inhibiting downstream signaling pathways.</p>

<p>Rabbit polyclonal p95 NBS1 antibody</p>

<p>Rabbit anti-cat IgG (H+L) (Rhodamine) was raised in rabbit using feline IgG whole molecule as the immunogen.</p>

Goat anti-rabbit IgG was raised in goat using rabbit IgG F(c) fragment as the immunogen.

Rabbit anti-human IgG (Rhodamine) was raised in rabbit using human IgG F(c) fragment as the immunogen.

Goat anti-rabbit IgG (H + L) (Fab'2) (Texas Red) was raised in goat using rabbit IgG whole molecule as the immunogen.

<p>The alpha Synuclein antibody is a highly specialized antibody that targets the protein alpha synuclein. It has been shown to have vasoactive intestinal peptide (VIP) neutralizing properties, as well as the ability to inhibit interferon-gamma (IFN-gamma) and transferrin. This antibody can be used in various applications, including research in the life sciences field.</p>

<p>Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.</p>

Rabbit polyclonal alpha catenin antibody

<p>The Tau antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to tau protein, a key player in neurodegenerative diseases such as Alzheimer's. By binding to tau protein, this monoclonal antibody helps to inhibit its aggregation and promote its clearance from the brain.</p>

Rabbit anti Cat IgG (H + L) secondary antibody

<p>Rabbit polyclonal Stathmin 1 antibody</p>

Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.

<p>ESX1 antibody was raised in rabbit using the N terminal of ESX1 as the immunogen</p>

<p>PAK6 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Akt2 antibody is a highly specific monoclonal antibody that targets Akt2, a protein involved in various cellular processes. This antibody is widely used in life sciences research to study the role of Akt2 in cell signaling pathways and its association with diseases such as cancer.</p>

<p>TCFAP2C antibody was raised in rabbit using the N terminal of TCFAP2C as the immunogen</p>

Phakinin antibody was raised in Guinea Pig using Phakinin purified from calf lens as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.

<p>Tgfb1 antibody was raised in rabbit using the middle region of TGFB1 as the immunogen</p>

<p>The STAT5A antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to STAT5A, a protein involved in various cellular processes. This monoclonal antibody has been extensively tested and proven to have high specificity and sensitivity.</p>

The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dys

The Estrogen Receptor alpha antibody is a highly specialized antibody that specifically targets and binds to the estrogen receptor alpha. This antibody is reactive and acidic in nature, allowing it to effectively bind to the receptor and modulate its activity. It has a strong affinity for the receptor binding site, ensuring efficient and specific interaction.

<p>Goat anti-human kappa chain (Fab'2) (HRP) was raised in goat using human kappa chain as the immunogen.</p>

GPRC5B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

TACR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

INSR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

This antibody reacts with heavy chains on human IgM (mu chain).

<p>DKK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

The BRCA1 antibody is a highly specialized product that is used in the field of Life Sciences. It is an antibody that specifically targets and binds to the BRCA1 protein, which is involved in DNA repair and maintenance. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA).

<p>acidic hair keratin K38 antibody was raised in Guinea Pig using synthetic peptide of human acidic hair (trichocytic) keratin K38 coupled to KLH as the immunogen.</p>

DPP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

Goat anti-human kappa chain (Fab'2) was raised in goat using human kappa light chain as the immunogen.

Goat anti Human IgA antibody conjugated to R-Phycoerythrin

<p>PTK2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

Rabbit anti-rat IgG (H+L) (Fab'2) was raised in rabbit using rat IgG whole molecule as the immunogen.

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

This antibody reacts with heavy chains on human IgG (gamma chain).

<p>Sheep polyclonal 17a Estradiol antibody</p>

Goat anti-mouse IgG (Fab'2) (HRP) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.

<p>Medroxyprogesterone Acetate antibody is a polyclonal antibody that specifically targets medroxyprogesterone, a synthetic hormone used in various medical applications. This antibody can be used for the detection and quantification of medroxyprogesterone in biological samples. It has been shown to have high specificity and sensitivity, making it an ideal tool for research in the field of reproductive health and endocrinology.</p>

<p>Rabbit anti-sheep IgG (FITC) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

<p>The GATA1 antibody is a highly effective and reliable tool used in Life Sciences research. This antibody is specifically designed to target and bind to the GATA1 protein, an important regulator of gene expression. It is commonly used in various applications, including immunohistochemistry (IHC), Western blotting, and flow cytometry.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

Mouse PMN antibody was raised in rabbit using mouse PMNs as the immunogen.

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

Rabbit polyclonal Stathmin 1 antibody

Goat anti Bird IgG (H + L) secondary antibody

TMEM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit anti-sheep IgG (H+L) (Alk Phos) was raised in rabbit using sheep IgG whole molecule as the immunogen.

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

UCP5 antibody was raised in rabbit using a 16 amino acid peptide from rat UCP5 as the immunogen.

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

Sheep polyclonal Isoxsuprine antibody

<p>Arp-T1 antibody was raised in Guinea Pig using synthetic N-terminal domain of human Arp-T1 protein coupled to KLH as the immunogen.</p>

Proteasome 20S LMP7 antibody was raised in rabbit using a synthetic peptide, C V(259) E S T D V S D L L H Q Y R E A(274), as the immunogen.

This antibody reacts with heavy chains on human IgA (alpha chain) and.

Donkey anti-goat IgG (H+L) (biotin) was raised in donkey using goat IgG whole molecule as the immunogen.

<p>Goat anti-Armenian Hamster IgG (H + L) (rhodamine) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen

VEGFR2 antibody is a monoclonal antibody that specifically targets and binds to vascular endothelial growth factor receptor 2 (VEGFR2). This antibody plays a crucial role in inhibiting the signaling pathway of VEGFR2, which is involved in angiogenesis and tumor growth. By blocking the interaction between VEGFR2 and its ligands, this antibody effectively neutralizes the activity of VEGFR2, preventing the formation of new blood vessels and inhibiting tumor growth.

This antibody reacts with heavy chains on human IgG (gamma chain).

<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

Sheep polyclonal Sulphanitran antibody

<p>Mouse Anti-Human IgG3 Hinge-HRP</p>

The c-Kit antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Kit protein, also known as CD117. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.

<p>The FKHR antibody is a polyclonal antibody that specifically targets the Forkhead box protein O1 (FKHR). This antibody is widely used in various life science applications, including immunoassays, diagnostic agents, and research studies. FKHR plays a crucial role in regulating gene expression and cellular processes related to growth, metabolism, and apoptosis.</p>

<p>The Pyk2 antibody is a highly specialized monoclonal antibody that targets the protein tyrosine kinase 2 (Pyk2). This antibody is widely used in research and diagnostic applications to study the role of Pyk2 in various cellular processes.</p>

The PDE10A Antibody is a high-quality polyclonal antibody that is used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) pathway and plays a crucial role in regulating cellular functions such as fatty acid metabolism and cell growth. This antibody is highly specific and has been extensively tested for its neutralizing activity against EGF and its inhibitors.

<p>Rabbit anti-chicken IgG (Alk Phos) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.</p>

Oxytocin antibody was raised in rabbit using Oxytocin conjugated to bovine thyroglobulin as the immunogen.

Goat anti-bovine IgG (FITC) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.

Goat anti-monkey IgG was raised in goat using monkey IgG gamma chain as the immunogen.

The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). It plays a crucial role in blocking the interaction between EGFR and its ligands, such as transforming growth factor-beta (TGF-beta) and epidermal growth factor (EGF). This antibody is available in both polyclonal and monoclonal forms, offering a wide range of applications in the field of life sciences.

<p>SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti-human kappa chain (Alk Phos) was raised in goat using human k (kappa light chain) as the immunogen.</p>

<p>This antibody reacts with heavy chains on bovine IgG and light chains on all bovine immunoglobulins.</p>

Cholera toxin antibody was raised in rabbit using purified choleragenoid as the immunogen.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

<p>The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

IFN beta antibody was raised in rabbit using rat interferon beta as the immunogen.

Influenza A antibody (H1N1) was raised in goat using influenza A, strain USSR (H1N1) as the immunogen.

This antibody reacts with heavy chains on human IgM (mu chain).

<p>GRIK4 antibody was raised in rabbit using the N terminal of GRIK4 as the immunogen</p>

<p>Donkey anti-rabbit IgG (H + L) (Cy3) was raised in donkey using rabbit IgG (H&amp;L) as the immunogen.</p>

<p>Goat anti-human IgG (Fab'2) was raised in goat using human IgG F(c) fragment as the immunogen.</p>

The p70S6 Kinase antibody is a growth factor monoclonal antibody that is used in various bioassays within the Life Sciences field. This antibody specifically targets and binds to the p70S6 Kinase, a trifunctional enzyme that plays a crucial role in cell growth and protein synthesis. By inhibiting the activity of this kinase, the antibody can effectively regulate cellular processes and signaling pathways.

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>SMARCA3 antibody was raised in rabbit using the C terminal of SMARCA3 as the immunogen</p>

This antibody reacts with heavy chains on human IgG (gamma chain).

<p>Goat anti-human IgG (FITC) was raised in goat using human IgG gamma chain as the immunogen.</p>

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

<p>PARN antibody was raised in rabbit using the N terminal of PARN as the immunogen</p>

Benzodiazepines antibody was raised in sheep using benzodiazepine-BSA as the immunogen.

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>The Tau antibody is a specialized antibody that targets and inhibits the growth of endothelial cells. It belongs to the class of monoclonal antibodies that specifically bind to collagen, a protein found in the extracellular matrix. This antibody has been shown to have high affinity and specificity for its target, making it an effective tool for research and diagnostic purposes.</p>

<p>Rabbit anti-goat IgG (Alk Phos) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

<p>Rabbit anti-sheep IgG (H+L) (FITC) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

<p>Xanthine Oxidase antibody was raised in Guinea Pig using Xanthine oxidase purified from bovine milk fat globule membrane (MFGM) as the immunogen.</p>

The Opioid Receptor antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets the opioid receptor protein, which plays a crucial role in pain modulation and addiction pathways.