Primary Antibodies

<p>The YPEL5 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the YPEL5 protein, a basic protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Purified Polyclonal AMPK beta 1 antibody</p>

<p>IGF2BP2 antibody was raised using the middle region of IGF2BP2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS</p>

<p>FES antibody was raised in Mouse using a purified recombinant fragment of FES expressed in E. coli as the immunogen.</p>

<p>The Synaptotagmin antibody is a diagnostic reagent used in Life Sciences. It is an antibody that specifically binds to the protein Synaptotagmin, which plays a crucial role in neurotransmitter release. This antibody can be used for various applications, including research on synaptic transmission and the study of neurological disorders. The Synaptotagmin antibody is produced using recombinant cells and has high specificity and sensitivity. It is a valuable tool for scientists and researchers working in the field of neuroscience. Additionally, this antibody can also be used as a medicament for therapeutic purposes, such as targeting specific proteins involved in diseases like botulinum poisoning or calpain-related disorders. With its wide range of applications, the Synaptotagmin antibody is an essential tool for any researcher or clinician working in the field of Life Sciences.</p>

<p>Rabbit polyclonal UBR1 antibody</p>

Mouse monoclonal PDE4A antibody

<p>Rabbit polyclonal GPRIN2 antibody</p>

<p>CALM1 antibody was raised in Rabbit using Human CALM1 as the immunogen</p>

<p>The JAK2 antibody is a highly specialized product used in the field of Life Sciences. It is an immobilized polyclonal antibody that specifically targets tyrosine residues on JAK2 proteins. This antibody is designed to be used in various research applications, including the detection and quantification of activated JAK2 in human serum samples.</p>

<p>The FLT3LG antibody is a highly effective monoclonal antibody that is used in the field of Life Sciences. It has a high-flux capability, making it ideal for various applications such as antiviral research and interleukin detection. This antibody specifically targets FLT3 ligand, which plays a crucial role in regulating the growth and differentiation of hematopoietic stem cells. By binding to FLT3 ligand, the antibody inhibits its function and prevents abnormal cell proliferation. Additionally, this antibody has been shown to have a positive effect on carnitine metabolism and can be used as a therapeutic agent for certain metabolic disorders. With its exceptional specificity and potency, the FLT3LG antibody is an invaluable tool for researchers in the field of medicine and biomarker composition studies.</p>

<p>Rabbit polyclonal SLC30A7 antibody</p>

<p>MEPE antibody was raised in Rabbit using Human MEPE as the immunogen</p>

<p>Rabbit polyclonal MTR1L antibody</p>

<p>Protein kinase B, also known as Akt or RAC-alpha serine/threonine-protein kinase, is a serum- and glucocorticoid-regulated kinase with three closely related isoforms: Akt1, Akt2, and Akt3. While Akt1 and Akt3 are primarily expressed in the brain, Akt2 is most abundant in skeletal muscle and embryonic brown fat. These isoforms are key regulators in various physiological functions, including cell growth, proliferation, survival, angiogenesis, and metabolism, and Akt is also recognized as a proto-oncogene due to its role in cancer-related processes.</p>

<p>CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascitic fluid as the immunogen.</p>

<p>HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG</p>

<p>Mouse monoclonal ARK1 antibody</p>

<p>GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>Rabbit polyclonal GHITM antibody</p>

<p>The USP16 antibody is a highly specialized monoclonal antibody that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of USP16, an enzyme involved in mineralization and adipose tissue development. It has been widely used in immunoassays and research studies to investigate the function and regulation of USP16.</p>

<p>Purified Polyclonal Caspase 6 p18 antibody</p>

<p>Rabbit polyclonal ABCB7 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.</p>

Hsp27 antibody was raised in mouse using recombinant human Hsp27 (1-205aa) purified from E. coli as the immunogen.

<p>Mouse monoclonal ALDOB antibody</p>

Rat monoclonal TIM1 antibody (biotin)

<p>The CDC7 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets CDC7, a protein kinase involved in the regulation of cell cycle progression and DNA replication. This antibody can be used for various applications, such as immunofluorescence, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal SEC22B antibody</p>

<p>Rabbit polyclonal Synaptotagmin antibody (Thr202)</p>

The AIF antibody is a monoclonal antibody that specifically targets the apoptosis-inducing factor (AIF). This antibody has been widely used in life sciences research to study the role of AIF in various cellular processes. It acts as a neutralizing agent, inhibiting the activity of AIF and preventing its interaction with other proteins in the cell. The AIF antibody has shown promise as a potential therapeutic agent for diseases involving abnormal cell growth, such as cancer. Its ability to bind to specific antigens makes it a valuable tool for researchers studying protein complexes and signaling pathways. Additionally, this antibody has been found to interact with other molecules involved in lipid metabolism, insulin-like growth factor signaling, and nuclear receptors such as the mineralocorticoid receptor.

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>NUDT21 antibody was raised in mouse using recombinant Human Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (Nudt21)</p>

<p>Rabbit polyclonal RPL10A antibody</p>

<p>Mouse monoclonal CD235a antibody (biotin)</p>

<p>Rabbit polyclonal OR9G4 antibody</p>

<p>The RPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study insulin and its related functions. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most appropriate option for their specific needs.</p>

<p>EIF4H antibody was raised using the C terminal of EIF4H corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE</p>

RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN

<p>Rabbit polyclonal LATS antibody (Thr1079/1041)</p>

<p>RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN</p>

<p>Rabbit polyclonal LEF1 antibody (Ser42)</p>

<p>HNRNPC antibody was raised in Rabbit using Human HNRNPC as the immunogen</p>

Purified Polyclonal CK1 epsilon antibody

<p>Purified Polyclonal EDG3 antibody</p>

SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>The Cytochrome P450 2D6 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize the activity of the Cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism and can affect the efficacy and safety of various medications.</p>

<p>Rabbit polyclonal SEC61A1 antibody</p>

Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

<p>Purified Polyclonal CACNG1 antibody</p>

<p>Mouse monoclonal MAPK8 antibody</p>

Mouse monoclonal SLC2A5 antibody

<p>C13ORF7 antibody was raised using the N terminal Of C13Orf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG</p>

<p>The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.</p>

<p>The Myoglobin antibody is a highly specific monoclonal antibody that targets the myoglobin protein. It can be used in various applications, such as immunoassays, protein-protein interaction studies, and as an inhibitor in life science research. This antibody is produced using isolated nucleic acids and has been extensively tested for its specificity and sensitivity. It binds to myoglobin with high affinity, making it an ideal tool for detecting and quantifying myoglobin levels in biological samples. The Myoglobin antibody is conjugated with maleimide, allowing for easy coupling to microspheres or other surfaces for use in various experimental setups. Its immunosuppressant properties make it a valuable tool in understanding the role of myoglobin in different physiological processes. Trust the Myoglobin antibody for accurate and reliable results in your research endeavors.</p>

<p>CD5 antibody (PE) was raised in mouse using human CD5 as the immunogen.</p>

Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.

<p>SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN</p>

Mouse monoclonal PRKCE antibody

<p>Rabbit polyclonal APC antibody (Ser2054)</p>

<p>The SUZ12 antibody is a highly effective antiviral agent that belongs to the class of inhibitors in Life Sciences. It has been extensively studied for its ability to target specific growth factors and human serum components, making it a valuable tool in the field of virology. This low-molecular-weight antibody has shown promising results in treating thrombocytopenia, a condition characterized by low platelet count. Additionally, it has been found to possess neutralizing properties against influenza hemagglutinin, making it an ideal candidate for developing antiviral therapies. The SUZ12 antibody can be immobilized on electrodes for use in various applications, and its high specificity makes it an excellent choice for monoclonal antibody-based diagnostics and research.</p>

<p>AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP</p>

<p>The NGAL antibody is a specific antibody that targets the epidermal growth factor (EGF) and tumor necrosis factor-alpha (TNF-α). It falls under the category of Life Sciences and Monoclonal Antibodies. This antibody has been shown to have neutralizing effects on autoantibodies and growth factors such as collagen, transforming growth factor-beta (TGF-beta), and fibronectin. By targeting these factors, the NGAL antibody can help regulate cell signaling pathways and inhibit abnormal cell growth. Additionally, this antibody has been found to be effective in blocking the activation of chemokines, which play a crucial role in inflammation and immune response. With its high specificity and neutralizing properties, the NGAL antibody holds great potential for therapeutic applications in various fields of research and medicine.</p>

GnRHR antibody was raised in mouse using highly pure human gonadotropin releasing hormone receptor as the immunogen.

<p>Purified Polyclonal PPAR gamma antibody</p>

<p>The KRT8 antibody is a highly specialized monoclonal antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine, a neurotransmitter with cholinergic properties. The KRT8 antibody has been extensively tested and validated for its specificity and sensitivity in detecting choline acetyltransferase in human serum samples.</p>

<p>Rabbit polyclonal AKAP3 antibody</p>

<p>Adiponectin antibody was raised in mouse using recombinant human adiponectin (15-244aa) purified from E. coli as the immunogen.</p>

ANXA3 antibody is a monoclonal antibody that targets mesothelin, a growth factor that is overexpressed in various types of cancer. This antibody specifically binds to mesothelin and neutralizes its activity, inhibiting tumor growth and metastasis. ANXA3 antibody has been shown to have high specificity and affinity for mesothelin, making it an effective tool for diagnostic assays and potential therapeutic applications. Additionally, this antibody can be used in research studies to investigate the role of mesothelin in cancer development and progression. Overall, ANXA3 antibody offers promise as a valuable tool in the fight against cancer.

<p>IQWD1 antibody was raised in Rabbit using Human IQWD1 as the immunogen</p>

<p>BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD</p>

<p>EIF4G3 antibody was raised using the middle region of EIF4G3 corresponding to a region with amino acids MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES</p>

<p>Rabbit polyclonal PSMC6 antibody</p>

Mouse monoclonal ITFG2 antibody

The Giardia lamblia antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to Giardia lamblia, a common parasite that causes gastrointestinal infections in humans. This antibody works by recognizing and binding to specific proteins on the surface of Giardia lamblia, effectively neutralizing its activity and preventing further infection.

FBXL4 antibody was raised in mouse using recombinant Human F-Box And Leucine-Rich Repeat Protein 4 (Fbxl4)

<p>Rabbit polyclonal TSR2 antibody</p>

Rabbit polyclonal SMAP1 antibody

<p>Rabbit polyclonal RPS27L antibody</p>

Mouse monoclonal Toll-like receptor 2 antibody (FITC)

<p>The IGJ antibody is a monoclonal antibody that specifically targets insulin in the human body. It is designed to bind to insulin molecules and prevent their interaction with insulin receptors, thereby inhibiting their activity. This antibody is commonly used in Life Sciences research to study the role of insulin in various physiological processes.</p>

<p>The Septin 9 antibody is a highly specialized monoclonal antibody that targets a specific cell antigen. It has been extensively studied in the field of pluripotent stem cells and has shown promising results in various applications. This antibody has been used in research studies involving the treatment of cancer with doxorubicin, as well as in polymerase chain reactions (PCR) to detect specific messenger RNA molecules.</p>

<p>Rabbit polyclonal WDR4 antibody</p>

<p>Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.</p>

<p>The PLXDC2 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to specifically target and neutralize the activity of PLXDC2, a glycoconjugate receptor involved in various cellular processes. This antibody has been shown to be cytotoxic against cells expressing high levels of PLXDC2, making it a promising tool for targeted therapy.</p>

<p>The PEX5 antibody is a monoclonal antibody that targets fibronectin, a growth factor involved in various cellular processes. This antibody specifically binds to PEX5, a protein involved in peroxisome biogenesis and function. It has been shown to inhibit endothelial cell growth and proliferation, making it a potential therapeutic option for diseases characterized by abnormal blood vessel formation. Additionally, the PEX5 antibody has demonstrated efficacy as a multidrug combination therapy when used in conjunction with other targeted therapies, such as epidermal growth factor inhibitors or anti-HER2 antibodies like trastuzumab. Its ability to modulate signaling pathways involving β-catenin and VEGF-C further highlights its potential applications in life sciences research. With its high specificity and affinity for its target, the PEX5 antibody offers valuable insights into peroxisome biology and holds promise for future therapeutic interventions.</p>

<p>Rabbit Polyclonal MSK1 antibody (Thr581)</p>

<p>CD127 antibody is a polyclonal antibody that targets the TGF-beta protein. It is commonly used in life sciences research to study collagen and other related proteins. This antibody can be used in various applications, such as polymerase chain reaction (PCR), hybridization, and cytotoxic assays. CD127 antibody specifically binds to TGF-beta1 and can be used to detect its presence in samples. Additionally, this antibody has been shown to have an inhibitory effect on lectins, which are glycan-binding proteins. CD127 antibody is also known to promote the growth of human hepatocytes and exhibit natriuretic properties. Overall, this versatile antibody is a valuable tool for researchers studying TGF-beta signaling pathways and related biological processes.</p>

<p>Rabbit polyclonal SGCG antibody</p>

Mouse monoclonal PKLR antibody

<p>Mouse monoclonal HAGHL antibody</p>

Mouse monoclonal SYNJ2BP antibody

<p>Rabbit polyclonal WEE2 antibody</p>

<p>The ENPEP antibody is a highly specialized monoclonal antibody used in Life Sciences. It specifically targets the cysteine-rich protein and has been shown to inhibit the activity of tumor necrosis factor-alpha (TNF-α). This antibody is commonly used in research and diagnostic applications, particularly in the field of immunology. It can be used to detect and quantify ENPEP expression levels in human serum samples, providing valuable insights into various physiological processes.</p>

Sheep anti Bovine IgM secondary antibody (HRP)

<p>The SIGLEC9 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to the SIGLEC9 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to have high specificity and affinity for its target.</p>

<p>KLHL25 antibody was raised in Mouse using a purified recombinant fragment of human KLHL25 expressed in E. coli as the immunogen.</p>

<p>DHRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGR</p>

<p>Rabbit polyclonal TRIM3 antibody</p>

<p>Mouse monoclonal C6orf64 antibody</p>

<p>LIMK1 antibody was raised in Rabbit using Human LIMK1 as the immunogen</p>

<p>Rat monoclonal TER119 antibody (biotin)</p>

<p>Rabbit polyclonal RPS23 antibody</p>

<p>Rabbit Polyclonal RGS16 antibody (Tyr168)</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It effectively treats tuberculosis infections with its strong bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high efficacy has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

<p>The Claudin 7 antibody is a neuroprotective monoclonal antibody that targets the glycoprotein Claudin 7. This antibody has been specifically designed to neutralize the inhibitory factor of Claudin 7, making it an effective therapeutic option for various neurological disorders. By targeting the glycosylation process of Claudin 7, this antibody can modulate its function and promote neuroprotection.</p>

<p>Rabbit polyclonal THOC6 antibody</p>

<p>Purified Polyclonal Calcium Sensing Receptor antibody</p>

<p>The TOMM20 antibody is a growth factor that plays a crucial role in various biological processes. It is an antibody specifically designed to target and bind to TOMM20, an essential protein involved in mitochondrial import. This antibody can be used for research purposes in the field of life sciences, particularly in the study of mitochondrial function and dynamics.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is particularly effective in treating tuberculosis infections due to its strong bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>IFITM2 antibody was raised in Rabbit using Human IFITM2 as the immunogen</p>

<p>ITM2A antibody was raised in Rabbit using Human ITM2A as the immunogen</p>

<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody is commonly used in research laboratories and medical institutions for various applications.</p>

GTF2A2 antibody was raised in Rabbit using Human GTF2A2 as the immunogen

<p>Mouse monoclonal TGF beta antibody (biotin)</p>

The KEAP1 antibody is a highly specialized monoclonal antibody that targets KEAP1, a protein involved in the regulation of cellular responses to oxidative stress. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and neurodegenerative disorders.

<p>Rabbit polyclonal ERK3 antibody</p>

EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.

<p>Mouse monoclonal PARP16 antibody</p>

The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.

Rabbit polyclonal SYNJ2BP antibody

<p>Mouse monoclonal CAPZA1 antibody</p>

HCCA2 antibody was raised in mouse using recombinant Human Hcca2 Protein

<p>Rabbit polyclonal PUB11 antibody</p>

<p>The LPAR1 antibody is a monoclonal antibody that targets the Lysophosphatidic Acid Receptor 1 (LPAR1). It plays a crucial role in various cellular processes, including cell growth, migration, and survival. This antibody has been extensively studied in the field of life sciences and has shown promising results.</p>

IL1b antibody (biotin) was raised in goat using E. Coli derived recombinant human IL1 beta/IL1F2 as the immunogen.

<p>Human phosphopeptide (Ser876) immunogen; rabbit polyclonal PKD2 antibody (Ser876)</p>

Mouse monoclonal CXorf26 antibody

Mouse monoclonal UNG antibody

<p>The FRK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets erythropoietin and anti-VEGF, making it an essential tool for studying endothelial growth and antiangiogenic properties. The FRK antibody has been extensively tested and proven to be highly effective in inhibiting the growth factor responsible for angiogenesis. In addition, it has shown cytotoxic effects on cancer cells and has been used to assess microvessel density in tumor samples. This high-quality monoclonal antibody is a valuable asset for researchers and scientists working in the field of antibodies and natriuretic factors. Its colloidal nature ensures easy handling and accurate results, making it an indispensable tool for cutting-edge research in the Life Sciences field.</p>

<p>Rabbit polyclonal HAX1 antibody (biotin)</p>

Armenian Hamster monoclonal Dll1 antibody (PE)

<p>The ZXDC antibody is a highly specialized monoclonal antibody that targets a specific human protein. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody is designed to specifically bind to the ZXDC protein, forming a strong receptor binding interaction.</p>

<p>Rabbit polyclonal SFPQ antibody</p>

<p>HMGN2 antibody was raised in Rabbit using Human HMGN2 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The potency of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and hinders cell growth in culture.</p>

<p>Mouse monoclonal TUBB4 antibody</p>

BCCIP antibody was raised in Rabbit using Human BCCIP as the immunogen

The TRIM2 antibody is a highly specialized monoclonal antibody that plays a crucial role in ultrasensitive detection. It specifically targets the primary amino acid sequence of leukemia inhibitory factor (LIF), making it an essential tool for researchers in the field of Life Sciences.

The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>The SYK antibody is a polyclonal antibody that has cytotoxic effects on cancer cells. It specifically targets the plasminogen activator receptor (uPAR), alpha-fetoprotein (AFP), and other antigens involved in cancer cell growth and metastasis. This antibody can be used in life sciences research to study the role of these proteins in cancer development and progression. Additionally, it has potential as a therapeutic agent for the treatment of multidrug-resistant cancers. The SYK antibody can also be used in diagnostic applications, such as detecting the presence of specific antigens in patient samples. With its versatile applications and high specificity, this antibody is a valuable tool for researchers and clinicians working in the field of cancer biology.</p>

<p>Rabbit polyclonal Spa17 antibody (biotin)</p>

<p>RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR</p>

<p>Rabbit polyclonal ATP5G2 antibody</p>

<p>C19ORF47 antibody was raised using the middle region of C19Orf47 corresponding to a region with amino acids YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT</p>

<p>Rabbit polyclonal SLC38A4 antibody</p>

KLHL22 antibody was raised in Mouse using a purified recombinant fragment of human KLHL22 expressed in E. coli as the immunogen.

Mouse monoclonal SERPINB4 antibody

<p>Purified Polyclonal mGLUR6 antibody</p>

<p>Rabbit polyclonal CDK7 antibody (Thr170)</p>

<p>LILRA5 antibody was raised in Rabbit using Human LILRA5 as the immunogen</p>

<p>MAK16 antibody was raised in Rabbit using Human MAK16 as the immunogen</p>

<p>The PFKP antibody is a monoclonal antibody used in Life Sciences research. It has various applications, including the study of nonsteroidal anti-inflammatory drugs and growth factors. This antibody can be used as a selectable marker in cytometry analysis and is particularly useful in the study of pluripotent stem cells. The PFKP antibody is highly specific and can be used for various techniques such as polymerase chain reaction (PCR) and immunoprecipitation with nuclear extracts. Additionally, this antibody has been shown to have an effect on epidermal growth factor-induced apoptosis. Its high specificity makes it an essential tool for researchers studying antibodies, monoclonal antibodies, and even oncolytic adenoviruses.</p>

Mouse monoclonal Integrin alpha 3B antibody

<p>The TIMP3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets epidermal growth factor and has been widely used in studies related to alpha-fetoprotein, histidine, globulin, and mesenchymal stem cells. The TIMP3 antibody has shown neutralizing properties against caspase-9 and acts as a growth factor family kinase inhibitor. It is formulated with excipients to ensure stability and efficacy. This antibody is highly sought after by researchers in the field for its specificity and reliability in various applications.</p>

BTC antibody was raised in Rabbit using Human BTC as the immunogen

<p>Purified Rabbit polyclonal NFAT4 antibody (Ser165)</p>

<p>LARP4 antibody was raised in Rabbit using Human LARP4 as the immunogen</p>

TIGD3 antibody was raised using the middle region of TIGD3 corresponding to a region with amino acids FVDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRW

<p>MANBAL antibody was raised in Rabbit using Human MANBAL as the immunogen</p>

<p>The VANGL1 antibody is a highly specialized monoclonal antibody that targets the VANGL1 protein. This protein is primarily found in the apical membrane of cells and plays a crucial role in various biological processes. The VANGL1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to epidermal growth factor signaling, tyrosine phosphorylation, human folate transport, collagen synthesis, and anti-CD20 therapy.</p>

<p>The CD20 antibody is a glycoprotein that belongs to the family of polyclonal antibodies. It is commonly used in Life Sciences for various applications, including research and diagnostics. The CD20 antibody specifically targets the CD20 antigen, which is expressed on the surface of certain cells, such as B-cells and some types of cancer cells.</p>

<p>Rabbit polyclonal STT3A antibody</p>

<p>CBX1 antibody was raised in Rabbit using Human CBX1 as the immunogen</p>

<p>Rabbit polyclonal OR5AP2 antibody</p>

Purified Polyclonal MTND3 antibody

<p>AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY</p>

Mouse monoclonal SH3GL1 antibody

<p>FAM45B antibody was raised using the middle region of FAM45B corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR</p>

<p>HMHA1 antibody was raised in Rabbit using Human HMHA1 as the immunogen</p>

<p>Mouse monoclonal Ly49G antibody (PE)</p>

<p>Rat monoclonal CCR7 antibody (PE)</p>

<p>The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

<p>Rabbit polyclonal TNNC1 antibody</p>

<p>Purified Rabbit polyclonal OSBPL10 antibody</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>NEIL2 antibody was raised in mouse using recombinant Human Nei Like 2 (E. Coli)</p>

The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.

<p>Rabbit polyclonal ARHGDIA antibody</p>

Mouse monoclonal LIPG antibody

<p>Purified Polyclonal CK1 gamma 3 antibody</p>

The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.