Primary Antibodies

<p>The GLUT3 antibody is a polyclonal antibody that targets the glucose transporter 3 (GLUT3) protein. It is widely used in life sciences research to study the role of glucose transporters in various cellular processes.</p>

<p>Rabbit polyclonal Collagen VI alpha 2 antibody</p>

<p>Rabbit polyclonal PIP5K1B antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to treat tuberculosis infections and contains active compounds with potent bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>MMP3 antibody was raised in Rabbit using Human MMP3 as the immunogen</p>

<p>Mouse pan macrophages antibody was raised in rat using mouse lymph node tissue as the immunogen.</p>

The GRIN1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets the methyl transferase enzyme, which plays a crucial role in gene regulation and protein function. This antibody is commonly used in nuclear research to study the acetylation and phosphorylation of proteins involved in various cellular processes.

<p>Rabbit polyclonal DAPK2 antibody (Ser318)</p>

<p>GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS</p>

<p>The GR antibody is a highly specialized antibody that targets the p38 MAPK pathway. It has antiviral properties and is particularly effective against acidic environments. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also binds to nuclear factor kappa-light-chain-enhancer, which regulates gene expression. The GR antibody is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in life sciences research. It can be used in immunoassays to detect the presence of activated p38 mitogen-activated protein kinase (MAPK) and caspase-9, as well as growth factors. With its high specificity and sensitivity, the GR antibody is an invaluable tool for researchers studying various cellular processes and signaling pathways.</p>

<p>Rabbit polyclonal 5HT4 antibody</p>

<p>Rabbit polyclonal Tau antibody (Thr231)</p>

<p>DHX29 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 29 (Dhx29)</p>

<p>The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.</p>

<p>Rabbit polyclonal APC1 antibody (Ser355)</p>

<p>Rabbit polyclonal MAPKAPK5 antibody</p>

<p>The Influenza B antibody is a highly specialized antibody that targets the influenza B virus. It works by neutralizing the virus surface antigen, preventing it from infecting healthy cells. This antibody is classified as a monoclonal antibody, meaning it is produced from a single clone of immune cells. It has been shown to have cytotoxic effects on infected cells and can also activate immune responses such as the production of interleukin-6 and interferon-gamma.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high efficacy in human activity using a patch-clamp technique on human erythrocytes.</p>

<p>CAMK2D antibody was raised in Rabbit using Human CAMK2D as the immunogen</p>

Mouse monoclonal CBWD1 antibody

<p>FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN</p>

Prekallikrein antibody (HRP) was raised in sheep using human active site-blocked Kallikrein prepared from plasma as the immunogen.

<p>AAMP antibody was raised in Rabbit using Human AAMP as the immunogen</p>

<p>The MIF antibody is a potent neutralizing agent that targets the growth factor and chemokine known as Macrophage Migration Inhibitory Factor (MIF). This polyclonal antibody binds to MIF, preventing its interaction with other molecules and inhibiting its biological activity. By blocking the action of MIF, this antibody can modulate immune responses, including the production of interferon and colony-stimulating factors. Additionally, it has antiviral properties and may play a role in regulating cell adhesion through interactions with E-cadherin. With its high specificity and effectiveness, the MIF antibody is a valuable tool for researchers studying immune responses and inflammatory diseases.</p>

<p>Rabbit polyclonal AMOTL1 antibody</p>

HSV1 gD antibody was raised in mouse using herpes simplex I and II-infected cells as the immunogen.

<p>Mouse monoclonal MAPK7 antibody</p>

<p>Rabbit polyclonal IKBB antibody (Ser23)</p>

<p>CD3 antibody was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>Rabbit polyclonal COT antibody (Thr290)</p>

<p>The STAR antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to glial fibrillary acidic protein (GFAP), a protein primarily found in the cytoskeleton of astrocytes. This antibody has been extensively validated for its high specificity and sensitivity in detecting GFAP expression in various tissues and cell types.</p>

<p>The TRIM38 antibody is a powerful tool used in the field of biomedical research. It is a polyclonal antibody that specifically targets TRIM38, an oxidase-like protein involved in various cellular processes. This antibody can be used to detect and quantify TRIM38 in pluripotent stem cells, making it an essential component for studying the role of this protein in stem cell biology.</p>

<p>Mouse monoclonal GSC antibody</p>

Rabbit polyclonal Vimentin antibody (Ser56)

<p>The PCT monoclonal antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets annexin, a protein involved in the regulation of phosphorylcholine. This monoclonal antibody is produced by a hybridoma cell strain, which is a fusion of two different types of cells - a B-cell and a myeloma cell.</p>

<p>TNF alpha antibody was raised in mouse using human recombinant tumor necrosis factor alpha as the immunogen.</p>

RAB10 antibody was raised in Mouse using a purified recombinant fragment of human RAB10 expressed in E. coli as the immunogen.

<p>Rabbit polyclonal SFRS17A antibody</p>

<p>Purified Polyclonal MRPS12 antibody</p>

<p>Rabbit polyclonal RSK1/2/3/4 antibody (Ser221/227/218/232)</p>

<p>NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK</p>

<p>Rabbit Polyclonal Chk1 antibody (Ser345)</p>

<p>Rabbit polyclonal AHSA1 antibody</p>

<p>CDK7 antibody was raised in Rabbit using Human CDK7 as the immunogen</p>

<p>ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP</p>

<p>14.3.3 beta antibody is apolyclonal antibody, which is generated in rabbit and specifically targets the 14-3-3 beta protein isoform.The mode of action involves the binding of the antibody to the 14-3-3 beta protein, a member of the 14-3-3 protein family, which is known for its role in regulating a broad range of cellular processes, including signal transduction, apoptosis, and cell cycle control. Upon binding, the antibody can be utilized in various detection methods such as Western blotting, immunohistochemistry, or immunoprecipitation.The 14.3.3 beta antibody is extensively used in research focused on understanding the mechanistic pathways of cellular regulation, and its disruptions may be linked to various diseases, including cancer and neurodegenerative disorders. This makes it a crucial tool for scientists investigating cell signaling pathways and developing potential therapeutic strategies targeting the 14-3-3 proteins.</p>

Rabbit polyclonal CRGF antibody (FITC)

<p>Rabbit Polyclonal Cyclin B1 antibody (Ser147)</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ</p>

<p>Purified Polyclonal HCCS antibody</p>

<p>Affinity purified Rabbit polyclonal Cytokeratin 2 antibody</p>

<p>Rabbit polyclonal NFKB1 antibody (HRP)</p>

<p>MDM4 antibody was raised in rabbit using the N terminal of MDM4 as the immunogen</p>

<p>Transferrin antibody (Texas Red) was raised in rabbit using human transferrin as the immunogen.</p>

<p>Mouse monoclonal CD4 antibody (FITC); human immunogen; IgG1 kappa; clone RPA-T4</p>

INTS10 antibody was raised in Rabbit using Human INTS10 as the immunogen

Rabbit polyclonal PDSS2 antibody

<p>Purified Polyclonal Frizzled 6 antibody</p>

<p>Rabbit polyclonal CAF1A antibody</p>

<p>Purified Polyclonal NCKX2 antibody</p>

<p>The BTK antibody is a specific monoclonal antibody that targets Bruton's tyrosine kinase (BTK). It is commonly used in the field of Life Sciences for research purposes. BTK is an important protein kinase involved in various cellular processes, including the development and activation of immune cells. This antibody specifically binds to BTK, inhibiting its activity and interfering with downstream signaling pathways.</p>

<p>DOK2 antibody was raised in rabbit using the C terminal of DOK2 as the immunogen</p>

<p>Purified Rabbit polyclonal MADS50 antibody</p>

<p>Purified Polyclonal Complement C1R LC antibody</p>

The CD80 antibody is a collagen-based monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the CD80 protein, which is an important immune checkpoint molecule involved in T-cell activation. The antibody has been shown to effectively block the interaction between CD80 and its receptor, leading to the inhibition of T-cell activation and proliferation.

Rabbit Polyclonal p53 antibody (Ser315)

Rabbit polyclonal SCUBE3 antibody

<p>CA2 antibody was raised in Rabbit using Human CA2 as the immunogen</p>

<p>Rabbit Polyclonal POU2F1 antibody (Ser385)</p>

<p>The Keratin 8 antibody is a disulfide bond-based polyclonal antibody that specifically targets and detects the presence of Keratin 8. This antibody is commonly used in life sciences research, particularly in studies involving cell biology and molecular biology. It can be used for various applications such as immunohistochemistry, western blotting, and ELISA.</p>

Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.

<p>Rabbit polyclonal TRADD antibody</p>

<p>HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE</p>

<p>FABP antibody is a growth factor that has been modified with colloidal acid to enhance its neutralizing properties. It specifically targets lipoprotein lipase and inhibits its activity, making it an effective tool in studying the role of lipoproteins in various biological processes. This antibody has undergone glycosylation, which improves its stability and bioavailability. FABP antibody is commonly used in Life Sciences research, particularly in studies involving interferon and monoclonal antibodies. It can be immobilized on cellulose for purification purposes or used as a detection tool in assays. Whether you need a monoclonal or polyclonal antibody, FABP antibody is a valuable tool for your research needs.</p>

<p>SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA</p>

<p>CD40 antibody (Azide free) was raised in rat using CD40 as the immunogen</p>

DGCR2 antibody was raised in Rabbit using Human DGCR2 as the immunogen

PPP1R13L antibody was raised in mouse using recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 13 Like (Ppp1R13L)

<p>Rabbit polyclonal PGM2L1 antibody</p>

<p>MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL</p>

<p>The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>The ITGB4 antibody is a highly specialized biomolecule that acts as an inhibitor of growth factors. It specifically targets nuclear and nucleotide molecules, preventing them from activating certain cellular processes. This monoclonal antibody has been shown to have a high affinity for the tyrosine residues on the surface of cells, effectively blocking their interaction with growth factor receptors.</p>

ERCC5 antibody was raised in Rabbit using Human ERCC5 as the immunogen

<p>Rabbit polyclonal AQP12 antibody</p>

FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST

<p>Mouse monoclonal PPARA antibody</p>

<p>CYP27A1 antibody was raised in Rabbit using Human CYP27A1 as the immunogen</p>

<p>MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ</p>

CCBL1 antibody was raised in Rabbit using Human CCBL1 as the immunogen

<p>Rabbit polyclonal EIF3S2 antibody</p>

<p>The Chk2 antibody is a highly specific antibody that is used in Life Sciences research to detect and study the Chk2 protein. This protein plays a crucial role in cell cycle regulation and DNA damage response. The Chk2 antibody is generated using high-quality monoclonal or polyclonal antibodies, ensuring accurate and reliable results.</p>

<p>Rabbit polyclonal RPL9 antibody</p>

<p>The ROCK2 antibody is a protein that has neutralizing properties against collagen. It belongs to the class of polyclonal antibodies and is used in Life Sciences research. This antibody specifically targets ROCK2, which stands for Rho-associated coiled-coil containing protein kinase 2. ROCK2 is involved in various cellular processes, including cell proliferation, migration, and contraction. The ROCK2 antibody can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). It is available in both monoclonal and polyclonal forms. The antibody can be immobilized on chromatographic resins or used for protein-protein interaction studies. Additionally, it can be used to study the role of ROCK2 in hepatocyte growth factor signaling pathways or to investigate its binding partners such as angptl3 or growth factor binding proteins.</p>

<p>Rabbit polyclonal TNFAIP8 antibody</p>

<p>Purified Polyclonal Cytochrome P450 3A4 antibody</p>

<p>CTDSP2 antibody was raised in Rabbit using Human CTDSP2 as the immunogen</p>

<p>Rabbit polyclonal Goat Serum Albumin antibody (HRP)</p>

<p>DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF</p>

<p>Rabbit Polyclonal p62Dok antibody (Tyr362)</p>

<p>Mouse monoclonal GSTM1 antibody</p>

<p>Mouse monoclonal TulP3 antibody</p>

The SCOT antibody is a highly specialized antibody that targets specific chemokine receptors in the body. It has been extensively tested and proven to effectively bind to glucose-6-phosphate, steroid, and other test compounds. This antibody is widely used in the field of Life Sciences for research purposes, as it plays a crucial role in studying the pathogenic effects of various diseases.

<p>NDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGAL</p>

<p>Rabbit polyclonal NFkB p100 antibody (Ser872)</p>

The CD90.2 antibody is a highly sensitive fluorescent probe that is used for ultrasensitive detection in various applications. It is a monoclonal antibody that specifically targets the CD90.2 antigen, which is a cell surface marker found on various cell types, including immune cells and stem cells. This antibody can be used in research and diagnostic settings to detect the presence of CD90.2 in samples such as human serum or tissue sections.

EIF4ENIF1 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (Eif4Enif1)

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively tested using advanced techniques like the patch-clamp technique on human erythrocytes, confirming its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, ensuring effective utilization within the body. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains and inhibit cell growth, this drug is a valuable weapon against tuberculosis.</p>

<p>IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>Mouse monoclonal ELK3 antibody</p>

Rabbit polyclonal SFXN3 antibody

<p>The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.</p>

<p>TUPLE1 antibody was raised in mouse using recombinant H.Sapiens Tup1-Like Enhancer Of Split Gene 1 (Tuple1)</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>The ESR1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is specifically designed to target the estrogen receptor alpha (ERα), which plays a crucial role in various cellular processes. This monoclonal antibody binds to ERα, inhibiting its activity and preventing it from binding to estrogen.</p>

<p>MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK</p>

<p>HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA</p>

<p>NSD1 antibody was raised in mouse using recombinant Human Nuclear Receptor Binding Set Domain Protein 1 (Nsd1)</p>

Rabbit polyclonal RTF1 antibody

The DHFR antibody is a monoclonal antibody that is used in Life Sciences research. It is commonly used to detect and study antiphospholipid antibodies, which are associated with various autoimmune disorders such as heparin-induced thrombocytopenia. The DHFR antibody can also be used to investigate the role of interferon and caffeine in cellular processes.

Rabbit polyclonal SEPSECS antibody

<p>Cytokeratin 7 antibody is a highly specific monoclonal antibody that targets the protein complex of cytokeratin 7. It is commonly used in Life Sciences research to study various cellular processes and functions. This antibody has been shown to have high affinity for cytokeratin 7, making it a valuable tool for detecting and quantifying this protein in different biological samples.</p>

<p>Mouse monoclonal DFFA antibody</p>

Mouse monoclonal VGlut2 Transporter

<p>Purified Polyclonal QSER1 antibody</p>

<p>Purified Rabbit polyclonal DNAJB11 antibody</p>

<p>The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.</p>

<p>Rabbit polyclonal PLCG1 antibody (Tyr783)</p>

<p>Mouse monoclonal MIF4GD antibody</p>

<p>The GPR151 antibody is a monoclonal antibody that specifically targets the human mitochondrial protein GPR151. This protein is involved in various cellular processes, including epidermal growth factor signaling and regulation of cell proliferation. The GPR151 antibody can be used in Life Sciences research, particularly in the study of mitochondrial function and signaling pathways.</p>

<p>RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR</p>

IDS antibody is an intraocular antibody that plays a crucial role in the immune response. This monoclonal antibody specifically targets and neutralizes adeno-associated virus (AAV), which is commonly associated with various ocular diseases. IDS antibody works by binding to the viral antigens, preventing them from infecting host cells and causing damage. Additionally, this antibody has been shown to have antiviral properties, inhibiting the replication of AAV and reducing viral load. IDS antibody is a promising therapeutic option for individuals suffering from ocular conditions caused by AAV infections. Its specificity and ability to neutralize the virus make it a valuable tool in the field of life sciences and ophthalmology research.

<p>CIB1 antibody was raised in mouse using recombinant human CIB1 (1-191aa) purified from E. coli as the immunogen.</p>

JMJD2A antibody was raised in mouse using recombinant Omo Sapiens Jumonji Domain Containing 2A

<p>The S1PR1 antibody is a monoclonal antibody that targets the S1P receptor 1, a cell surface receptor involved in various cellular processes such as growth factor signaling and chemokine-induced migration. This antibody specifically recognizes and binds to the S1P receptor 1, blocking its activation and downstream signaling pathways. It has been extensively used in Life Sciences research to study the role of S1P receptor 1 in different biological processes.</p>

CYP11A1 antibody was raised using the N terminal of CYP11A1 corresponding to a region with amino acids QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL

<p>SEC5 antibody is a highly versatile growth factor that plays a crucial role in various biological processes. This globulin is widely used in Life Sciences research as both polyclonal and monoclonal antibodies. SEC5 antibody has been shown to interact with aldo-keto reductase, an enzyme involved in the metabolism of various compounds. It also acts as an inhibitory factor against certain antiviral activities, making it a valuable tool in virology research. Additionally, SEC5 antibody has been found to modulate the expression of E-cadherin, a protein involved in cell adhesion and migration. With its wide range of applications and excellent specificity, SEC5 antibody is an essential component for any researcher working in the fields of interferon, chemokine, or colony-stimulating factor research.</p>

The NSE antibody is a powerful tool in the field of life sciences. It is an interferon that exhibits cytotoxic properties and specifically targets transthyretin. This antibody binds to transthyretin, a protein that plays a crucial role in various biological processes. By binding to transthyretin, the NSE antibody can modulate its activity and function.

<p>The XRCC5 antibody is a polyclonal antibody that specifically targets XRCC5, also known as Ku80. XRCC5 is a glycoprotein that plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is commonly used in life sciences research to study the function and localization of XRCC5 in various cellular processes.</p>

<p>RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT</p>

<p>ANKRD11 antibody was raised in mouse using recombinant Human Ankyrin Repeat Domain 11 (Ankrd11)</p>

<p>KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ</p>

Mouse monoclonal SH2D2A antibody

<p>GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ</p>

Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.

<p>HAAO antibody was raised using the N terminal of HAAO corresponding to a region with amino acids HRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVG</p>

<p>Rabbit polyclonal GPR62 antibody</p>

The EpCAM antibody is a monoclonal antibody that has been developed through recombinant technology. It specifically targets the epithelial cell adhesion molecule (EpCAM), which is expressed on the surface of various types of cancer cells. By binding to EpCAM, this antibody inhibits the growth and spread of cancer cells.

<p>The IL17F antibody is a powerful tool in the field of Life Sciences. It is specifically designed to target and neutralize the effects of IL17F, an important cytokine involved in various inflammatory processes. This antibody has been extensively tested and proven to effectively block IL17F activity, making it a valuable asset in research and therapeutic applications.</p>

Mouse monoclonal XRCC1 antibody

<p>EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA</p>

<p>Rabbit polyclonal SPR antibody</p>

<p>Rabbit polyclonal RBM8A antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>The CIRE antibody is a monoclonal antibody that specifically targets actin filaments. It has been widely used in the field of Life Sciences for various applications. This antibody has shown high affinity towards actin, a protein involved in cell structure and movement. By binding to actin, the CIRE antibody can modulate cellular processes such as cell division and migration.</p>

<p>The BECN1 antibody is a monoclonal antibody that specifically targets and binds to the influenza hemagglutinin glycoprotein. This antibody has been shown to activate phosphatase activity, which plays a crucial role in regulating various cellular processes. Additionally, the BECN1 antibody has been found to interact with fibrinogen and modulate its function.</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>Purified Rabbit polyclonal MDM2 antibody (Ser166)</p>

<p>The MEK1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes MEK1, a protein involved in cell signaling pathways. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.</p>

Rabbit polyclonal SNUPN antibody

<p>Purified Polyclonal PMCA2 antibody</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>The PAR4 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Protease-Activated Receptor 4 (PAR4) in various biological processes. PAR4 plays a crucial role in cellular signaling pathways, particularly those involving epidermal growth factors and growth factors. By binding to PAR4, this antibody effectively inhibits its activation by proteases, preventing downstream effects such as the release of inflammatory cytokines and interferons.</p>

<p>Rabbit polyclonal HIST1H4E antibody</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The MEKK2 antibody is an immunomodulatory substance that targets a specific phosphorylation site on collagen. It is designed to recognize and bind to this site, leading to the modulation of immune responses. This antibody can be used in various applications, including research studies, vaccine development, and the production of therapeutic antibodies.</p>

<p>Rabbit polyclonal CBCP6 antibody</p>

Rabbit polyclonal GOLGA2 antibody

<p>The ABL1 antibody is a monoclonal antibody that specifically targets the growth factor receptor ABL1. This biomolecule plays a crucial role in cell growth, division, and survival. The ABL1 antibody is designed to bind to the activated form of ABL1, neutralizing its function and preventing further downstream signaling.</p>

<p>Rabbit polyclonal PIAS3 antibody</p>

<p>Mouse monoclonal PRKAA1 antibody</p>

<p>Mouse monoclonal TAB1 antibody (N-terminus)</p>

<p>Rabbit polyclonal IQCB1 antibody</p>

<p>Rabbit polyclonal SCN5A antibody</p>

<p>Rabbit Polyclonal OR5P2 antibody</p>

Rabbit polyclonal RNF133 antibody

<p>Rabbit polyclonal SCPX antibody</p>

<p>The ZFP36 antibody is a highly effective neutralizing agent that targets the TGF-beta protein. This monoclonal antibody contains histidine and is designed to inhibit the function of TGF-beta, a key molecule involved in various cellular processes. It acts as a potent family kinase inhibitor, blocking the activity of target molecules and preventing their downstream effects.</p>

<p>The BMPR2 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is designed to target and bind to the BMPR2 protein, which plays a crucial role in various cellular processes. This antibody is widely used in research and diagnostic applications due to its ability to detect and quantify the expression of BMPR2.</p>

<p>Rabbit polyclonal HRH3 antibody</p>

<p>Purified Polyclonal KLK11 antibody</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

Rabbit polyclonal RBM14 antibody

<p>Rabbit polyclonal GBAP antibody</p>