Primary Antibodies

<p>The Plexin B2 antibody is a biochemical compound that specifically targets estrogen receptors. It is a monoclonal antibody that has neuroprotective properties and can be used for various applications in the field of research and medicine. This antibody is highly specific and binds to denatured glycan structures, hormone peptides, and steroids. It also has the ability to recognize glycosylation patterns on proteins, making it a valuable tool for studying protein modifications. The Plexin B2 antibody is known for its neutralizing effects on certain molecules and can be used as an anti-connexin agent. It is produced through recombinant technology, ensuring high purity and consistency in every batch.</p>

<p>Integrin beta 3 antibody is a highly specialized antibody that targets and neutralizes the activity of TGF-β1 and IFN-gamma. This antibody has been extensively studied for its ability to bind to specific proteins involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, offering a wide range of options for researchers.</p>

<p>OSTF1 antibody was raised in rabbit using the N terminal of OSTF1 as the immunogen</p>

<p>TNNI3K antibody was raised using the N terminal of TNNI3K corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED</p>

<p>CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW</p>

<p>The HEV ORF2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ORF2 protein of the hepatitis E virus (HEV), which is responsible for viral replication and assembly. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>

Rabbit polyclonal TIMM17A antibody

<p>ZNF21 antibody was raised in rabbit using the middle region of ZNF21 as the immunogen</p>

<p>Ret antibody was raised in Mouse using a purified recombinant fragment of Ret(aa896-1063) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal USH1C antibody</p>

<p>FXR1 antibody was raised in Rabbit using Human FXR1 as the immunogen</p>

<p>Rabbit polyclonal RBL2 antibody</p>

<p>Rabbit Polyclonal GATA1 antibody (Ser142)</p>

<p>BGN antibody was raised in Rabbit using Human BGN as the immunogen</p>

<p>Rabbit polyclonal Bcl6 antibody (Ser333)</p>

<p>PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE</p>

<p>The ENO2 antibody is a highly specialized immunosuppressant that targets protein-protein interactions. It specifically binds to ENO2 dimers, which play a crucial role in various cellular processes. This monoclonal antibody has been extensively studied and characterized for its ability to inhibit the activity of ENO2, thereby preventing its interaction with other molecules.</p>

<p>The LKB1 antibody is a polyclonal antibody that specifically targets the growth factor LKB1. It has a high affinity for LKB1 and can be used in various research applications. This antibody has been shown to bind to serum albumin, making it suitable for use in immunohistochemistry and immunofluorescence assays. Additionally, the LKB1 antibody can detect glutamate, actin, and cytotoxic molecules in samples, making it a versatile tool for studying cellular processes. It is also available as a monoclonal antibody for more specific applications. The LKB1 antibody is activated by sulphates present in human serum, allowing for accurate detection of LKB1 levels in biological samples. In the field of Life Sciences, this antibody is commonly used to study autoantibodies and phosphatase activity. Its ability to label actin filaments makes it particularly useful for visualizing cytoskeletal structures.</p>

<p>Rabbit polyclonal VPS8 antibody</p>

<p>Mouse monoclonal PFDN6 antibody</p>

<p>The GST Tag antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the glutathione S-transferase (GST) tag, a commonly used protein fusion tag. This antibody is invaluable for detecting and quantifying GST-tagged proteins in various applications.</p>

<p>TARP antibody was raised in rabbit using the N terminal of TARP as the immunogen</p>

<p>Purified Polyclonal Caspase 2 p18 antibody</p>

<p>Purified Polyclonal KA2 antibody</p>

<p>The Cytokeratin 18 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various research applications, particularly in the study of adipocytes and endothelial growth. This antibody has been extensively tested and proven to be effective in neutralizing specific targets such as caspase-9, which is involved in apoptosis.</p>

<p>GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK</p>

<p>Rabbit polyclonal CaMK2 antibody (Thr286)</p>

<p>Purified Polyclonal RBBP6 antibody</p>

<p>Rabbit polyclonal CD45 antibody (Ser1007)</p>

<p>Rabbit polyclonal SENP3 antibody</p>

<p>PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM</p>

<p>SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR</p>

<p>Mouse monoclonal DENV2 ED2 antibody</p>

<p>MRI1 antibody was raised in Rabbit using Human MRI1 as the immunogen</p>

<p>GOLPH3 antibody was raised in Rabbit using Human GOLPH3 as the immunogen</p>

<p>The MSX1 antibody is a specific antibody that targets the MSX1 protein. This protein plays a crucial role in various biological processes, including collagen synthesis, insulin regulation, and adiponectin receptor signaling. The MSX1 antibody is widely used in Life Sciences research to study the expression and function of MSX1 in different tissues and cell types.</p>

<p>ALKBH7 antibody was raised in Rabbit using Human ALKBH7 as the immunogen</p>

<p>HLA-ABC Monoclonal Antibody</p>

<p>Armenian Hamster monoclonal gamma delta TCR antibody (FITC)</p>

<p>The HSP20 antibody is a polyclonal antibody that targets heat shock protein 20 (HSP20). This antibody is widely used in life sciences research to study the functions and mechanisms of HSP20. HSP20 is a small heat shock protein that plays a crucial role in cellular stress response and protection against various environmental stresses. It interacts with other proteins, such as calmodulin, epidermal growth factor, and colony-stimulating factors, to regulate cell growth, proliferation, and survival. The HSP20 antibody is highly specific and exhibits neutralizing activity against HSP20. It can be used in various applications, including Western blotting, immunofluorescence staining, and enzyme-linked immunosorbent assay (ELISA). This high-quality antibody is produced using advanced techniques and has been validated for its performance in multiple experiments. It is supplied in a convenient format suitable for use in both research laboratories and commercial settings.</p>

<p>Loxl2 antibody was raised in rabbit using the C terminal of Loxl2 as the immunogen</p>

<p>The IFN alpha antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is known for its antiviral properties. This antibody specifically targets CD20 antibodies, making it an effective tool for research and therapeutic applications.</p>

<p>Purified Polyclonal Kv10.1 antibody</p>

<p>Purified Polyclonal Peroxiredoxin 3 antibody</p>

MRPL44 antibody was raised in Rabbit using Human MRPL44 as the immunogen

<p>C11ORF53 antibody was raised using the middle region of C11Orf53 corresponding to a region with amino acids SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN</p>

<p>Rabbit polyclonal Alkylphenols antibody</p>

<p>Rabbit polyclonal SH2D2A antibody</p>

<p>Mouse monoclonal GAPDHS antibody</p>

Rabbit polyclonal WSB1 antibody

<p>NAPB antibody was raised in rabbit using the N terminal of NAPB as the immunogen</p>

<p>Rabbit polyclonal NDUFS8 antibody (FITC)</p>

<p>The EFTUD2 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody targets c-myc, a protein involved in various cellular processes. It can be used for research purposes, such as studying the role of c-myc in insulin signaling or investigating its interaction with other proteins.</p>

<p>Mouse monoclonal Morphine 3 antibody</p>

<p>The CYP2C19 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to the CYP2C19 enzyme, which plays a crucial role in drug metabolism. By inhibiting the activity of this enzyme, the CYP2C19 antibody can have a significant impact on the effectiveness and safety of certain medications.</p>

<p>AK7 antibody was raised in rabbit using the C terminal of AK7 as the immunogen</p>

<p>The SIX6 antibody is a monoclonal antibody that targets the SIX6 protein, which plays a crucial role in hepatocyte growth and collagen production. This antibody specifically binds to the apical membrane of cells and inhibits the activity of phosphatase enzymes, leading to a decrease in collagen synthesis. The SIX6 antibody can be used in various assays to study the function of this protein and its potential as a target for therapeutic interventions. Additionally, this antibody has been shown to have potential as an antibody-drug conjugate, where it can deliver tyrosine kinase inhibitors directly to cancer cells expressing high levels of SIX6. The glycosylation of the SIX6 protein has also been found to be important for its stability and function. Overall, the SIX6 antibody is a valuable tool for researchers in the field of life sciences studying hepatocyte growth and related processes.</p>

<p>Purified Rabbit polyclonal MRC1 antibody</p>

<p>Recombinant hnRNP C1+C2 Monoclonal Antibody</p>

<p>The RBBP7 antibody is a monoclonal antibody used in Life Sciences research. It is commonly used to detect and study the protein RBBP7, which plays a crucial role in various cellular processes. This antibody specifically binds to RBBP7 and can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>C21orf58 antibody was raised using the N terminal of C21orf58 corresponding to a region with amino acids MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW</p>

MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN

<p>Purified Polyclonal PGRMC2 antibody</p>

<p>Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT</p>

<p>CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF</p>

<p>Mouse monoclonal PYCR2 antibody</p>

<p>Rabbit polyclonal RNF7 antibody</p>

<p>Affinity purified Rabbit polyclonal MAPK 8/9 antibody</p>

<p>EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP</p>

<p>MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>Rabbit polyclonal Stathmin 1 antibody (Ser24)</p>

<p>The CD71 Antibody is a highly effective monoclonal antibody that has a wide range of applications in the field of biomedical research. This antibody specifically targets CD71, also known as transferrin receptor protein 1, which is expressed on the surface of cells and plays a crucial role in iron metabolism.</p>

<p>KLH antibody is a highly specialized antibody that specifically targets and binds to key proteins involved in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different areas of research.</p>

<p>RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI</p>

<p>Rabbit polyclonal CaMK2 beta/gamma/delta antibody (Thr287)</p>

<p>CYP2A6 antibody was raised in Rabbit using Human CYP2A6 as the immunogen</p>

<p>The MAP1 antibody is a highly specialized monoclonal antibody that targets the alpha-fetoprotein (AFP) and its associated growth factor. This antibody specifically binds to the tyrosine kinase receptor of AFP, inhibiting its activity and preventing further cellular growth and proliferation. The MAP1 antibody has been extensively tested using electrode techniques and has shown remarkable specificity and effectiveness in neutralizing AFP.</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>Rabbit polyclonal ACBD6 antibody</p>

<p>Rabbit polyclonal GM2A antibody (biotin)</p>

<p>CPOX antibody was raised in Rabbit using Human CPOX as the immunogen</p>

<p>Mouse monoclonal Aeromonas caviae antibody</p>

<p>The Cathepsin B antibody is a highly effective monoclonal antibody that targets the cyclase-activating peptide (CAP). It is widely used in Life Sciences research to study various biological processes. This antibody has been shown to neutralize the activity of cathepsin B, an important enzyme involved in the degradation of fatty acids and collagen. The Cathepsin B antibody recognizes a conformational epitope on cathepsin B, making it highly specific for this target. In addition, this antibody can be used in combination with Polyclonal Antibodies to detect and quantify biomolecules in complex samples. The Cathepsin B antibody has also been found to have cytotoxic effects on certain cell types, making it a valuable tool for studying cell signaling pathways. Whether you are conducting basic research or developing new therapeutic strategies, the Cathepsin B antibody is an essential tool for your studies.</p>

<p>Affinity purified Rabbit polyclonal Fibrinogen gamma antibody</p>

<p>Rabbit polyclonal SPAG7 antibody</p>

<p>B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI</p>

<p>CLSTN1 antibody was raised in Rabbit using Human CLSTN1 as the immunogen</p>

<p>Mouse monoclonal PAICS antibody</p>

<p>Mouse monoclonal gamma Actin antibody</p>

<p>Mouse monoclonal HMOX2 antibody</p>

<p>MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI</p>

<p>The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.</p>

<p>Mouse monoclonal DYNC1LI1 antibody</p>

<p>SLC43A3 antibody was raised using the N terminal of SLC43A3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD</p>

WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH

<p>The FYN antibody is a highly specialized product used in the field of Life Sciences. It is designed to target and inhibit the activity of the FYN protein kinase, which plays a crucial role in various cellular processes. By blocking the activation of FYN, this antibody can help researchers gain insights into the function and regulation of tyrosine kinase receptors, alpha-fetoprotein, chemokines, and other important molecules.</p>

<p>EphA8 antibody was raised in Mouse using a purified recombinant fragment of EphA8(aa70-150) expressed in E. coli as the immunogen.</p>

<p>CUL2 antibody was raised in rabbit using the middle region of CUL2 as the immunogen</p>

<p>The ANXA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role as a growth factor and has been extensively studied for its therapeutic potential. This antibody has shown remarkable efficacy in various experimental settings, including electrode-based assays and collagen-related studies.</p>

<p>Affinity purified Rabbit polyclonal PLEKHG4 antibody</p>

<p>Rabbit polyclonal Tyrosine Hydroxylase antibody (Ser19)</p>

<p>RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids  DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM</p>

<p>The Cofilin antibody is a monoclonal antibody that specifically targets and binds to cofilin, a protein involved in cell motility and actin dynamics. This antibody has been extensively studied in various research fields, including life sciences and collagen studies. It has shown promising results in assays related to protein kinase activity, chemokine signaling, and tyrosine phosphorylation. Additionally, the Cofilin antibody has been used as a tool for investigating the role of cofilin in diseases such as cancer and autoimmune disorders. With its high specificity and effectiveness, this antibody is a valuable asset for researchers looking to study cofilin-related pathways and mechanisms.</p>

<p>The FHIT antibody is a highly specialized growth factor that plays a crucial role in proteolytic processes. It belongs to the family of antibodies used in Life Sciences research and is specifically designed to target glycopeptides. The FHIT antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>The VAV2 antibody is a powerful tool for researchers studying the effects of oncostatin and its inhibitors. This polyclonal antibody specifically targets acidic peptides and has been shown to have neutralizing effects on TGF-beta. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA. The VAV2 antibody has been validated for use in multiple species, making it versatile for different experimental models. Researchers can rely on this monoclonal antibody to accurately detect and measure the levels of VAV2 in samples such as liver microsomes and nuclear extracts. With its high specificity and sensitivity, the VAV2 antibody is an essential tool for investigating the role of VAV2 in various cellular processes, including collagen synthesis, β-catenin signaling, dopamine regulation, and growth factor pathways.</p>

<p>Rabbit polyclonal FUS antibody (FITC)</p>

<p>The ApoA4 antibody is a monoclonal antibody that specifically targets the antigen binding domain of Apolipoprotein A4 (ApoA4). It has been shown to inhibit dipeptidyl peptidase 4 (DPP4) activity, which plays a role in regulating blood lipids. The antibody contains an amino group and amide bond, allowing it to bind to specific epitopes on ApoA4. This interaction leads to the inhibition of DPP4 activity and promotes hepatocyte growth. Additionally, the ApoA4 antibody can be used as a DNA vaccine or combined with other natural compounds to enhance its therapeutic effects. Its unique structure and mechanism make it a promising candidate for the treatment of various life sciences-related conditions related to blood lipids and DPP4 activity.</p>

<p>IFN beta antibody was raised in rat using mouse interferon beta as the immunogen.</p>

<p>MLLT4 antibody was raised in Rabbit using Human MLLT4 as the immunogen</p>

<p>The PROX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to glucose-6-phosphate, providing valuable insights into its role in various cellular processes. Additionally, this antibody has shown neuroprotective properties and can inhibit the production of antiphospholipid antibodies, which are associated with autoimmune disorders. The PROX1 antibody also has applications in the study of collagen activation and insulin signaling pathways. With its high specificity and affinity, this antibody is a powerful tool for researchers studying these important biological processes.</p>

<p>Mouse monoclonal TBC1D21 antibody</p>

<p>Rabbit polyclonal EPHB1/2 antibody (Tyr594/604)</p>

<p>Rabbit polyclonal Breast Tumor Kinase antibody (Tyr447)</p>

<p>DNAJB6 antibody was raised in Rabbit using Human DNAJB6 as the immunogen</p>

The CD29 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and detect the presence of CD29, also known as integrin beta-1, on the surface of cells. CD29 is an essential cell adhesion molecule that plays a crucial role in various cellular processes, including cell migration, proliferation, and differentiation.

<p>The DPP3 antibody is a highly reactive and neutralizing antibody that is used in life sciences research. It is commonly used in assays to detect and measure the levels of DPP3, a protein found in human serum. This antibody can be immobilized on an electrode or buffered solution for easy detection and analysis. Additionally, the DPP3 antibody has been shown to have potential therapeutic applications, such as in antibody-drug conjugates or targeted therapies. It can also be used to study the role of DPP3 in various biological processes, including fibrinogen metabolism, protein carbonylation, and the behavior of mesenchymal stem cells. With its high specificity and versatility, the DPP3 antibody is an essential tool for researchers in the field of life sciences.</p>

<p>LEFTY2 antibody was raised in Rabbit using Human LEFTY2 as the immunogen</p>

<p>Rabbit polyclonal SYN1 antibody (Ser603)</p>

<p>The RBBP5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the phosphatase RBBP5, which plays a crucial role in various cellular processes. This antibody has shown potential in studies related to adipose tissue, amyloid plaque formation, and lipase activity.</p>

<p>CBLL1 antibody was raised in Rabbit using Human CBLL1 as the immunogen</p>

<p>Rabbit polyclonal PCDHB5 antibody</p>

<p>ARHGEF7 antibody was raised in Rabbit using Human ARHGEF7 as the immunogen</p>

<p>Purified Rabbit polyclonal CAB1R antibody</p>

<p>The BRCA1 antibody is a polyclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to BRCA1, a protein complex involved in various cellular processes such as DNA repair and cell cycle regulation. This antibody has been extensively tested and validated for its high specificity and sensitivity in detecting BRCA1 expression in different tissues and cell types.</p>

<p>Rabbit polyclonal MYOD antibody (Ser200)</p>

PTH1R antibody was raised in Mouse using a purified recombinant fragment of human PTH1R expressed in E. coli as the immunogen.

<p>The MUC1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the MUC1 protein, which is involved in various cellular processes. This antibody has been extensively studied and proven to have high affinity for MUC1 dimers.</p>

<p>BMP2K antibody was raised using the C terminal of BMP2K corresponding to a region with amino acids  AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV</p>

<p>Rabbit polyclonal ELOA3 antibody</p>

<p>Rabbit polyclonal USP29 antibody</p>

<p>TNFRSF10C antibody was raised in rabbit using the N terminal of TNFRSF10C as the immunogen</p>

<p>Purified Rabbit polyclonal AurB antibody (Tyr12)</p>

<p>FAM160B1 antibody was raised using the N terminal of FAM160B1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH</p>

<p>Affinity purified Rabbit polyclonal BCAP31 antibody</p>

<p>AMOTL1 antibody was raised in Rabbit using Human AMOTL1 as the immunogen</p>

<p>Mouse monoclonal UBL4A antibody</p>

<p>SLC25A46 antibody was raised using the N terminal of SLC25A46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP</p>

<p>Rabbit polyclonal TNFSF11 antibody (HRP)</p>

<p>Purified Polyclonal NACAD antibody</p>

<p>The GPR56 antibody is a highly specialized protein complex that plays a crucial role in various biological processes. It acts as a growth factor, regulating cell growth and development. This antibody is known for its viscosity properties, allowing it to bind tightly to its target molecules.</p>

<p>Purified Polyclonal ABCD4 antibody</p>

<p>The GLO1 antibody is a highly specific monoclonal antibody used in life sciences research. It targets the carboxy terminal of the human enzyme glyoxalase 1 (GLO1), which is a serum marker and has been associated with various diseases. This antibody is designed to detect autoantibodies against GLO1, allowing for the exploration of their role in disease development and progression. The GLO1 antibody has been extensively validated and is suitable for use in various applications, including immunohistochemical detection. Its high affinity and specificity ensure accurate and reliable results. With its spherical morphology and tetramerization domain, this monoclonal antibody provides excellent binding to the target protein, making it an invaluable tool for researchers in the field of life sciences.</p>

<p>Affinity purified Rabbit polyclonal TRAM1 antibody</p>

<p>Rabbit polyclonal ATG16L1 antibody</p>

<p>Rabbit polyclonal EXTL3 antibody (FITC)</p>

<p>The DGKA antibody is a mouse monoclonal antibody that specifically targets opioid peptides. This antibody has been developed for use in various research applications within the Life Sciences field. It has been shown to form stable complexes with phenyl phosphate and exhibit chemotactic activity. The DGKA antibody is highly specific, making it an ideal tool for studying steroid metabolites and androgen biosynthesis. With its ability to form hydrogen bonds, this monoclonal antibody provides valuable insights into the complex mechanisms of opioid peptide signaling. Researchers can rely on the DGKA antibody to enhance their understanding of these important biological processes.</p>

<p>Affinity purified Rabbit polyclonal NLRP4G antibody</p>

<p>CD45.1 antibody was raised in mouse using CD45.1 as the immunogen.</p>

<p>The Histone H3 antibody is a specific antibody that targets the nuclear β-catenin, which plays a crucial role in various cellular processes. This antibody has been shown to interact with other proteins such as leukemia inhibitory factor and interleukin-6, indicating its involvement in growth factor signaling pathways. Additionally, the Histone H3 antibody has been found to modulate cholinergic and dopamine neurotransmission, suggesting its potential impact on neurological functions.</p>

<p>Rabbit polyclonal BRCA1 antibody (Ser1524)</p>

<p>Rabbit Polyclonal PPP1R2 antibody (Ser120+Ser121)</p>

<p>The KRAS antibody is a highly specialized diagnostic agent used in the field of molecular biology and medical research. This antibody specifically targets KRAS, a protein that plays a crucial role in cell signaling and growth regulation. By binding to KRAS, this antibody can help researchers understand the function and activity of this protein.</p>

<p>Mouse monoclonal CD154 antibody (PE)</p>

<p>Mouse monoclonal Dengue NS1 antibody (Subtype 1); Supplied in PBS buffer with sodium azide</p>

<p>Affinity purified Rabbit polyclonal SDCCAG3 antibody</p>

<p>LYVE1 antibody was raised in Rabbit using Human LYVE1 as the immunogen</p>

OCT4 antibody was raised in Mouse using synthesized peptide derived from internal of human POU5F1 as the immunogen.

<p>ERBB2 antibody was raised in Mouse using a purified recombinant fragment of human ERBB2 (aa750-987) expressed in E. coli as the immunogen.</p>

<p>TOR2A antibody was raised using the N terminal of TOR2A corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS</p>

<p>Rabbit Polyclonal GIDRP88 antibody</p>

<p>Affinity purified Rabbit polyclonal ADCK4 antibody</p>

<p>Rabbit polyclonal PEX7 antibody</p>

<p>Rabbit polyclonal UBAC1 antibody</p>

<p>Affinity purified Rabbit polyclonal HSD17B4 antibody</p>

<p>SPAG4L antibody was raised using the N terminal of SPAG4L corresponding to a region with amino acids MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNIL</p>

<p>The beta Tubulin antibody is a highly specialized antibody that targets the beta tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes. The beta Tubulin antibody has been extensively studied and proven to be effective in detecting and quantifying beta tubulin in various biological samples.</p>

Factor IX antibody was raised in mouse using human factor IX as the immunogen.

<p>Rabbit polyclonal BUD31 antibody</p>

<p>Purified Polyclonal MGCRACGAP antibody</p>

Rabbit polyclonal PSMA3 antibody

<p>Rabbit polyclonal RPL27A antibody</p>

<p>STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)</p>

<p>Cytokeratin 1 antibody was raised in mouse using human epidermal keratin as the immunogen.</p>

<p>LONP1 antibody was raised in Rabbit using Human LONP1 as the immunogen</p>

<p>CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP</p>

<p>The AKT1 antibody is a cholinergic monoclonal antibody that targets the AKT1 protein. It plays a crucial role in various cellular processes, including cell survival, growth, and proliferation. This antibody specifically binds to the AKT1 protein, inhibiting its function and preventing downstream signaling pathways.</p>

<p>Rabbit polyclonal PPP2R2C antibody</p>

<p>Rabbit polyclonal XPF antibody</p>

H2AFX antibody was raised using the N terminal of H2AFX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY

<p>Rabbit polyclonal ATF2 antibody (Ser62or44)</p>

<p>CD147 antibody was raised in mouse using human T cell line Molt 13 as the immunogen.</p>

<p>Purified Rabbit polyclonal RACK1A antibody</p>

<p>RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER</p>

<p>The ATR antibody is a polyclonal antibody that is commonly used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and epinephrine, two important hormones involved in cell growth and signaling pathways. This antibody has been shown to have neutralizing effects on EGF-like inhibitory factors, which can block the activity of EGF and other growth factors. Additionally, the ATR antibody can also bind to albumin and serum albumin, two proteins commonly found in human serum. This makes it a valuable tool for studying protein-protein interactions and identifying potential therapeutic targets. Whether you're conducting research or developing new treatments, the ATR antibody is an essential tool for any scientist in the field of Life Sciences.</p>