Primary Antibodies

<p>DRGX antibody was raised in rabbit using the middle region of DRGX as the immunogen</p>

<p>USP15 antibody was raised in rabbit using the C terminal of USP15 as the immunogen</p>

<p>XPO5 antibody was raised in rabbit using the middle region of XPO5 as the immunogen</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant murine MIP-1a as the immunogen.</p>

<p>PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH</p>

<p>OR1D2 antibody was raised in rabbit using the C terminal of OR1D2 as the immunogen</p>

<p>OLIG3 antibody was raised in rabbit using the N terminal of OLIG3 as the immunogen</p>

<p>MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG</p>

<p>SDF2 antibody was raised using the middle region of SDF2 corresponding to a region with amino acids RDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEG</p>

<p>SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF</p>

SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids GRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVH

<p>The ATF2 antibody is a glycosylated polyclonal antibody that has cytotoxic activity against tumor necrosis factor-alpha (TNF-α). It is commonly used in Life Sciences research to study the role of ATF2, a nuclear receptor, in various cellular processes. This antibody can be used in experiments involving oral haloperidol, teriparatide, interferon, and dopamine. Additionally, it has been shown to inhibit the production of interleukin-6 (IL-6), a pro-inflammatory cytokine. The ATF2 antibody is a valuable tool for researchers studying biomolecules and protein complexes involved in signal transduction pathways.</p>

<p>Stk25 antibody was raised in rabbit using the C terminal of Stk25 as the immunogen</p>

<p>FHL5 antibody was raised in rabbit using the middle region of FHL5 as the immunogen</p>

<p>CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR</p>

<p>DUX3 antibody was raised in rabbit using the N terminal of DUX3 as the immunogen</p>

<p>IP10 antibody was raised in rabbit using highly pure recombinant murine IP-10 as the immunogen.</p>

<p>Plakophilin 2 antibody was raised using the N terminal of PKP2 corresponding to a region with amino acids HPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPP</p>

<p>IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF</p>

<p>The HNF4 alpha antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the HNF4 alpha protein, which plays a crucial role in regulating gene expression and cellular functions. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>Acp2 antibody was raised in rabbit using the middle region of Acp2 as the immunogen</p>

<p>MUC3B antibody was raised using the middle region of MUC3B corresponding to a region with amino acids KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA</p>

<p>A4GNT antibody was raised using the N terminal of A4GNT corresponding to a region with amino acids LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME</p>

<p>HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT</p>

<p>Slc26a2 antibody was raised in rabbit using the C terminal of Slc26a2 as the immunogen</p>

<p>Purified Polyclonal USP32 antibody</p>

<p>PHF20L1 antibody was raised in rabbit using the N terminal of PHF20L1 as the immunogen</p>

<p>C14ORF180 antibody was raised using the N terminal Of C14Orf180 corresponding to a region with amino acids RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS</p>

<p>The TAU antibody is a highly specialized molecule drug that belongs to the class of monoclonal antibodies. It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. This antibody specifically targets and binds to TAU protein, which is involved in various cellular processes such as insulin signaling, anti-VEGF activity, protein kinase regulation, and more.</p>

<p>ZMAT3 antibody was raised in rabbit using the N terminal of ZMAT3 as the immunogen</p>

<p>Cyb5r1 antibody was raised in rabbit using the N terminal of Cyb5r1 as the immunogen</p>

<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>

<p>SEMA4B antibody was raised using the N terminal of SEMA4B corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS</p>

<p>KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP</p>

<p>IKK-gamma antibody was raised in rabbit using residues 385-399 [RRSPPEEPPDFCCPK] of the IKK-gamma protein as the immunogen.</p>

<p>Neuroserpin antibody was raised in rabbit using highly pure recombinant human neuroserpin as the immunogen.</p>

<p>SERPINB13 antibody was raised in rabbit using the middle region of SERPINB13 as the immunogen</p>

<p>Monopolin antibody was raised in rabbit using protein from Saccharomyce cerevisiae as the immunogen.</p>

<p>LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW</p>

<p>Nbr1 antibody was raised in rabbit using the C terminal of Nbr1 as the immunogen</p>

<p>Pnkd antibody was raised in rabbit using the N terminal of Pnkd as the immunogen</p>

<p>NFYC antibody was raised in rabbit using the C terminal of NFYC as the immunogen</p>

<p>HOXA5 antibody was raised in rabbit using the middle region of HOXA5 as the immunogen</p>

<p>CYP8B1 antibody was raised in rabbit using the middle region of CYP8B1 as the immunogen</p>

<p>SERPINA3 antibody was raised using the middle region of SERPINA3 corresponding to a region with amino acids FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL</p>

PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG

<p>STAT6 antibody was raised in rabbit using the C terminal of STAT6 as the immunogen</p>

<p>UGT2A3 antibody was raised using the middle region of UGT2A3 corresponding to a region with amino acids GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR</p>

<p>CPXCR1 antibody was raised in rabbit using the middle region of CPXCR1 as the immunogen</p>

<p>KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY</p>

<p>ZNF428 antibody was raised in rabbit using the N terminal of ZNF428 as the immunogen</p>

<p>Amigo2 antibody was raised in rabbit using the middle region of Amigo2 as the immunogen</p>

<p>NUP98 antibody was raised in rabbit using the N terminal of NUP98 as the immunogen</p>

<p>TNF alpha antibody was raised in goat using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP</p>

<p>SLC35A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET</p>

<p>UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL</p>

<p>PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR</p>

<p>TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV</p>

<p>SYT5 antibody was raised in rabbit using the middle region of SYT5 as the immunogen</p>

<p>SOX7 antibody was raised in rabbit using the middle region of SOX7 as the immunogen</p>

<p>CDH5 antibody was raised in rabbit using the middle region of CDH5 as the immunogen</p>

St6gal2 antibody was raised in rabbit using the C terminal of St6gal2 as the immunogen

<p>VEGF antibody was raised in rabbit using highly pure recombinant murine VEGF as the immunogen.</p>

<p>PDZK1 antibody was raised in rabbit using the N terminal of PDZK1 as the immunogen</p>

<p>Ku80 antibody was raised in rabbit using residues 323-338 [FSKVDEEQMKYKSEGK] of the 80 kDa Ku80 protein as the immunogen.</p>

<p>CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD</p>

<p>CLK1 antibody was raised in rabbit using the N terminal of CLK1 as the immunogen</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG</p>

<p>SAP30BP antibody was raised in rabbit using the N terminal of SAP30BP as the immunogen</p>

<p>ABCD2 antibody was raised in rabbit using the N terminal of ABCD2 as the immunogen</p>

NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ

<p>Rabbit polyclonal GFAP antibody (Prediluted for IHC)</p>

SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ

IL20 antibody was raised in goat using highly pure recombinant human IL-20 as the immunogen.

<p>CD22 antibody was raised in rabbit using the N terminal of CD22 as the immunogen</p>

<p>Purified Polyclonal AHRL antibody</p>

<p>ST6GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL</p>

<p>Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL</p>

<p>Purified Polyclonal CAMK2A antibody</p>

<p>C1QA antibody was raised in rabbit using the N terminal of C1QA as the immunogen</p>

<p>NT3 antibody was raised in rabbit using highly pure recombinant human NT-3 as the immunogen.</p>

<p>Pcnp antibody was raised in rabbit using the C terminal of Pcnp as the immunogen</p>

<p>AAV5 antibody was raised in rabbit using residues 530-541 [NSQPANPGTTATC] of 80 kDa capsid VP3 protein of AAV 5 as the immunogen.</p>

<p>BRD4 antibody was raised in rabbit using the C terminal of BRD4 as the immunogen</p>

<p>Dag1 antibody was raised in rabbit using the C terminal of Dag1 as the immunogen</p>

<p>Notch 2 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 2 (NOTCH2) protein as the immunogen.</p>

<p>RSV antibody was raised in rabbit using Residues 81-95 [LESYIGSINNITKQSA] of the human RSV M2 protein as the immunogen.</p>

<p>IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA</p>

<p>UPF2 antibody was raised in rabbit using the N terminal of UPF2 as the immunogen</p>

<p>HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL</p>

<p>ZFYVE28 antibody was raised in rabbit using the N terminal of ZFYVE28 as the immunogen</p>

<p>SLC22A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR</p>

<p>ARHGEF2 antibody was raised in rabbit using the C terminal of ARHGEF2 as the immunogen</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV</p>

<p>RHEBL1 antibody was raised using the middle region of RHEBL1 corresponding to a region with amino acids TRVPVVLVGNKADLSPEREVQAVEGKKLAESWGATFMESSARENQLTQGI</p>

SLC25A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT

<p>Cyyr1 antibody was raised in rabbit using the middle region of Cyyr1 as the immunogen</p>

<p>INTS4 antibody was raised in rabbit using the middle region of INTS4 as the immunogen</p>

<p>COX18 antibody was raised in rabbit using the middle region of COX18 as the immunogen</p>

<p>Med19 antibody was raised in rabbit using the N terminal of Med19 as the immunogen</p>

<p>Purified Polyclonal Lamin A/C antibody</p>

<p>XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS</p>

<p>KCNK10 antibody was raised using the N terminal of KCNK10 corresponding to a region with amino acids EKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSA</p>

CD163 antibody was raised in mouse using rat spleen cells as the immunogen.

<p>Rabbit polyclonal CDCA4 antibody</p>

<p>CLCA2 antibody was raised in Rabbit using Human CLCA2 as the immunogen</p>

<p>RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL</p>

Rabbit polyclonal VTCN1 antibody (FITC)

<p>SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA</p>

<p>Human sperm PSA immunogen; mouse anti-PSA/KLK3 Antibody</p>

<p>CXADR antibody was raised using the N terminal of CXADR corresponding to a region with amino acids ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK</p>

<p>JAK2 antibody was raised in Mouse using a purified recombinant fragment of JAK2(745-955aa) expressed in E. coli as the immunogen.</p>

<p>FEM1B antibody was raised in Rabbit using Human FEM1B as the immunogen</p>

<p>The CTNNB1 antibody is a monoclonal antibody that specifically targets and neutralizes the activated form of the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, migration, and proliferation. The CTNNB1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth and progression of certain types of cancer.</p>

<p>Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.</p>

The ALDH3A1 antibody is a highly specialized antibody that is used in the field of Life Sciences. It is an antigen-specific monoclonal antibody that has high affinity binding capabilities. This antibody is commonly used as a serum marker in various research studies and medical applications.

<p>MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL</p>

<p>MIER2 antibody was raised using the middle region of MIER2 corresponding to a region with amino acids RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE</p>

<p>HSD17B2 antibody was raised in Rabbit using Human HSD17B2 as the immunogen</p>

<p>Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT</p>

<p>SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM</p>

<p>The GALR2 antibody is a highly effective monoclonal antibody that specifically targets the GALR2 receptor. This antibody has been extensively studied and proven to have exceptional binding affinity and specificity. It can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal PUB75 antibody</p>

<p>Rabbit polyclonal VEGFR1 antibody (Tyr1333)</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through various scientific techniques, including the patch-clamp technique on human erythrocytes. This active compound undergoes several metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

<p>Rabbit polyclonal STA13 antibody</p>

<p>The RPS19 antibody is a highly effective inhibitor that targets tyrosine and nucleotide molecules. It works by blocking the growth factor, specifically the epidermal growth factor, which is essential for cell division and proliferation. This monoclonal antibody has been extensively studied in Life Sciences and has shown promising results in various research applications. It can be used in combination with other antibodies such as trastuzumab to enhance its therapeutic effects. The RPS19 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its ability to target specific biomolecules, including the anti-HER2 antibody, this antibody offers great potential for nuclear research and other applications in the field of biomedicine.</p>

ACPP antibody was raised in Rabbit using Human ACPP as the immunogen

<p>LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR</p>

<p>NAV1 antibody was raised in Rabbit using Human NAV1 as the immunogen</p>

<p>UGCG antibody was raised using the N terminal of UGCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL</p>

<p>TTC9C antibody was raised using the N terminal of TTC9C corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP</p>

CCNA1 antibody was raised in Rabbit using Human CCNA1 as the immunogen

<p>CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA</p>

<p>Purified Polyclonal Tryptase gamma antibody</p>

<p>Rabbit polyclonal PARD6B antibody</p>

<p>FBXW4 antibody was raised in Rabbit using Human FBXW4 as the immunogen</p>

<p>NANOS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDDDDSDEPGSRGRYLGSALELRALELCAGPAEAGLLEERFAELSPFAGR</p>

<p>P2Y2 antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human P2Y2 protein as the immunogen.</p>

<p>The CD28 antibody is a monoclonal antibody that inhibits the activity of CD28, a protein found on the surface of activated T cells. This antibody has been widely used in life sciences research to study the role of CD28 in immune responses. It specifically binds to CD28 and prevents its interaction with other molecules such as dopamine and vasoactive intestinal peptide, thereby modulating T cell activation and function. The CD28 antibody is highly specific for human CD28 protein and has been shown to effectively block its activity in various experimental settings. It can be used in applications such as flow cytometry, immunohistochemistry, and Western blotting to detect and analyze CD28 expression levels. Additionally, this antibody has been used to investigate the presence of autoantibodies against CD28 in certain autoimmune diseases. Its high affinity for CD28 allows for efficient targeting and potential therapeutic applications in the future.</p>

<p>Rabbit polyclonal GRIN2B antibody (N-terminus)</p>

<p>Rabbit Polyclonal PKC theta antibody (Ser695)</p>

<p>ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN</p>

<p>The SOX11 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is designed to target and bind to specific proteins, such as globulin, in order to inhibit their activity. This antibody has been extensively studied and proven effective in various applications.</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody (Ser337)</p>

<p>Rabbit polyclonal HLA-DOA antibody</p>

<p>Rabbit polyclonal SLPI antibody (biotin)</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE</p>

<p>CER1 antibody was raised in Mouse using a purified recombinant fragment of human CER1 expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal NDUFA5 antibody</p>

The RHO antibody is a powerful monoclonal antibody that specifically targets the HER2 growth factor. It is commonly used in cancer treatment to inhibit the growth and spread of tumors. This antibody works by binding to the HER2 receptor on cancer cells, preventing the activation of downstream signaling pathways that promote cell proliferation and survival.

<p>The GRF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to dopamine, insulin, and insulin antibodies, allowing for precise detection and analysis of these molecules in various biological samples. The GRF1 antibody has been extensively tested and validated for its specificity and sensitivity.</p>

Rabbit polyclonal VSNL1 antibody

<p>The CDH2 antibody is a growth factor that targets specific proteins involved in cell signaling pathways. It is commonly used in Life Sciences research to study the effects of various growth factors, such as trastuzumab and interferon, on cellular processes. This monoclonal antibody specifically binds to CDH2, a lysine-specific cell adhesion molecule, and inhibits its activity. The binding of the CDH2 antibody to CDH2 prevents the interaction of CDH2 with other binding proteins, thereby disrupting important cellular functions. This neutralizing effect has been demonstrated through spectrometric and electrode analysis. Additionally, the CDH2 antibody has shown potential as an effective therapeutic agent for targeting epidermal growth factor receptors and enhancing the immune response by promoting the production of antibodies and IFN-gamma.</p>

<p>Rabbit Polyclonal p53 antibody (Ser15)</p>

AOX1 antibody was raised in Rabbit using Human AOX1 as the immunogen

<p>Affinity purified Rabbit polyclonal OXSR1 antibody</p>

Purified Polyclonal NUB1 antibody

<p>The DCI antibody is a cytotoxic monoclonal antibody that specifically targets mesothelin, a protein expressed on the surface of certain cancer cells. It is used in Life Sciences research to study the role of mesothelin in various diseases and as a potential therapeutic target. The DCI antibody has been shown to inhibit the growth of cancer cells and induce cell death through multiple mechanisms. Additionally, it has been found to have low cross-reactivity with human serum proteins, minimizing potential side effects. This high-quality antibody is widely used in scientific research and holds great promise for future therapeutic applications.</p>

<p>Rabbit polyclonal TRP antibody (FITC)</p>

<p>CRABP1 antibody was raised in Rabbit using Human CRABP1 as the immunogen</p>

<p>GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF</p>

HHV8 antibody was raised in mouse using recombinant human ORF73/HHV8 (122-329aa) purified from E. coli as the immunogen.

entB Monoclonal Antibody

<p>Purified Polyclonal TSC22 antibody</p>

<p>Rabbit polyclonal RPA2 antibody (FITC)</p>

<p>Rabbit Polyclonal GPS2 antibody</p>

<p>Myostatin antibody was raised in Mouse using a purified recombinant fragment of Myostatin expressed in E. coli as the immunogen.</p>

<p>The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.</p>

<p>RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI</p>

<p>Rabbit polyclonal SOCS5 antibody</p>

<p>P2RXL1 antibody was raised using the N terminal of P2RXL1 corresponding to a region with amino acids ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN</p>

<p>The XIAP antibody is a monoclonal antibody that specifically targets the X-linked inhibitor of apoptosis protein (XIAP). This protein plays a crucial role in regulating cell death and survival pathways. The XIAP antibody binds to XIAP, preventing its interaction with caspases and promoting apoptosis in cancer cells.</p>

<p>FAM127B antibody was raised in Rabbit using Human FAM127B as the immunogen</p>

<p>The p27Kip1 antibody is a highly specialized tool used in the field of Life Sciences. It is an activated electrode that specifically targets and binds to p27Kip1, a protein involved in cell cycle regulation. This monoclonal antibody is designed to recognize and bind to p27Kip1 with high affinity and specificity, making it an essential tool for researchers studying cellular processes.</p>

<p>Rabbit Polyclonal ATP5H antibody</p>