Primary Antibodies

<p>Rabbit polyclonal PKC theta antibody</p>

<p>Rabbit polyclonal PLCG1 antibody (Tyr771)</p>

<p>Purified Rabbit polyclonal CBLN1 antibody</p>

<p>The PSA antibody is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA) found in human serum. It is designed to bind to PSA and inhibit its activity. This antibody is produced using histidine-tagged recombinant proteins and has been shown to effectively detect PSA levels in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISA) or immunohistochemistry.</p>

<p>ARL13B antibody was raised using the middle region of ARL13B corresponding to a region with amino acids RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Rabbit polyclonal SCAMP3 antibody (FITC)</p>

<p>CORO1A antibody was raised in Rabbit using Human CORO1A as the immunogen</p>

<p>Rabbit polyclonal RyR2 antibody (Ser2808)</p>

<p>Purified Rabbit polyclonal HOXA11 antibody</p>

<p>Rat monoclonal CD122 antibody (PE)</p>

<p>GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR</p>

Rabbit polyclonal SPCS2 antibody

<p>The BAD antibody is a globulin found in human serum that is commonly used in Life Sciences research. This antibody has shown promising potential as an anticancer agent and is widely used in the development of targeted therapies. It specifically targets and binds to adipose tissue, making it a valuable tool for studying adipose-related diseases and disorders. The BAD antibody has also been used to detect bovine γ-globulin, chemokine-activated cells, and reactive molecules involved in various molecular signaling pathways. Additionally, this antibody has demonstrated cytotoxic effects against certain cancer cells and has been utilized in studies investigating the therapeutic properties of compounds such as icariin and paliperidone. With its versatility and wide range of applications, the BAD antibody is an essential component in many research endeavors within the field of Life Sciences.</p>

<p>Rabbit polyclonal STAM2 antibody</p>

<p>Influenza A antibody was raised in mouse using Influenza A from A/Texas strain as the immunogen.</p>

<p>Rat monoclonal CD4 antibody (biotin); IgG2b kappa; clone RM4-4</p>

<p>Armenian Hamster monoclonal CD305 antibody (PE)</p>

<p>The FASN antibody is a highly specialized product in the field of Life Sciences. It is used for various applications such as chromatographic and electrophoresis techniques. This polyclonal antibody specifically targets the fatty acid synthase (FASN) antigen, which plays a crucial role in lipid metabolism. By inhibiting FASN activity, this antibody can be used to study the effects of FASN inhibitors on different cell lines, including mda-mb-231 cells. Additionally, this antibody can be utilized in assays to detect FASN expression levels and investigate its involvement in various cellular processes. The FASN antibody is available both as polyclonal and monoclonal antibodies, providing flexibility for researchers in their experiments.</p>

<p>The IL4 antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets and neutralizes interferon-gamma (IFN-gamma), a cytokine involved in immune responses. This antibody has been shown to have intraocular effects, particularly in the context of endothelial growth and autoantibodies. Additionally, it has been found to inhibit the activity of growth factors such as acetylcholine and chemokines. The IL4 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. With its ability to target and neutralize key molecules involved in immune responses, this antibody is an invaluable tool for studying the intricate workings of the immune system.</p>

<p>Please enquire for more information about HIV P24 antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Perilipin 2 (mouse N-terminus) guinea pig Polyclonal including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Affinity Purified Goat anti-Mouse C3 antibody:Jacobson A et al. Regulation of Murine Splenic B Cell CR3 Expression by Complement Component 3 J Immunol. 2009 Sep 15;183(6):3963-70. doi: 10.4049/jimmunol.0900038. Epub 2009 Aug 26.

<p>Affinity Purified Goat anti-Mouse C3 antibody:Jacobson A et al. Regulation of Murine Splenic B Cell CR3 Expression by Complement Component 3 J Immunol. 2009 Sep 15;183(6):3963-70. doi: 10.4049/jimmunol.0900038. Epub 2009 Aug 26.</p>

<p>Please enquire for more information about Affinity Purified anti-Mouse Albumin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgG Fraction Rabbit anti-BSA</p>

Rabbit anti-BSA antiserum.

This Monoclonal anti-Human Alpha Fetoprotein antibody is suitable for ELISA and LFD applications.

<p>Affinity Purified Goat anti-Human Alpha Fetoprotein Antibody</p>

<p>Borrelia Garinii Antigen is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about Borrelia Garinii Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about Human IgA antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urokinase High MW &gt;95% including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Murine anti-p26 HIV Monoclonal Antibody</p>

<p>Affinity purified Sheep polyclonal Bovine Transferrin antibody</p>

<p>MHC Class I antibody was raised in mouse using human HSB-2 t cell line as the immunogen.</p>

<p>MHC Class I antibody (biotin) was raised in mouse using human HSB-2 T cell line as the immunogen.</p>

<p>Luteinizing hormone beta antibody (HRP) was raised in mouse using human LH beta subunit as the immunogen.</p>

<p>Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.</p>

<p>Perforin antibody (PE) was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.</p>

Mouse anti-Cat Haptoglobin Antibody

<p>Purified Mouse anti-Human Cancer Antigen 125 (CA-125) Antibody.</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>Purified anti-Epididymis Protein 4 (HE4) Monoclonal Antibody</p>

<p>Used in ELISA and Lateral Flow applications.</p>

<p>Purified anti-Canine Heartworm Monoclonal Antibody</p>

<p>MHC class II antibody (FITC) was raised in mouse using purified class II from JY cell line as the immunogen.</p>

<p>Mouse IgG1 heavy chain antibody (biotin) was raised in rat using murine IgG1 as the immunogen.</p>

<p>INHBB antibody was raised in Rabbit using Human INHBB as the immunogen</p>

<p>Rabbit polyclonal Lactadherin antibody (biotin)</p>

<p>Rabbit polyclonal CKMT antibody (biotin)</p>

<p>Rabbit polyclonal STX3 antibody</p>

<p>DBP antibody was raised in mouse using recombinant Albumin D-Box Binding Protein</p>

<p>The PCT monoclonal antibody is a neutralizing protein used in the field of Life Sciences. It is an antibody that specifically targets and binds to urokinase plasminogen activator (uPA), inhibiting its activity. By blocking uPA, this antibody helps regulate thrombocytopenia, a condition characterized by low platelet levels. Additionally, the PCT monoclonal antibody exhibits cytotoxic effects on cells expressing high levels of uPA, making it a potential therapeutic option for certain diseases. This monoclonal antibody can also be used in research settings to study the role of uPA in various biological processes and as a diagnostic tool to measure uPA levels in patient samples. With its ability to target and modulate the activity of this important growth factor, the PCT monoclonal antibody holds promise as a medicament for various conditions involving aberrant uPA signaling pathways.</p>

<p>MITD1 antibody was raised in Rabbit using Human MITD1 as the immunogen</p>

<p>GIPC2 antibody was raised in Rabbit using Human GIPC2 as the immunogen</p>

<p>The mTOR antibody is a highly specialized monoclonal antibody that targets the phosphatase known as mammalian target of rapamycin (mTOR). This glycoprotein plays a crucial role in regulating cell growth, proliferation, and survival. By specifically binding to mTOR, this antibody inhibits its activity and disrupts downstream signaling pathways involved in cell cycle progression and protein synthesis.</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF</p>

<p>Rabbit polyclonal STXBP4 antibody</p>

<p>The ZHX2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to neutralize lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used as a research tool to study the function and regulation of lipoprotein lipase in various biological systems.</p>

<p>Rabbit polyclonal GBA3 antibody</p>

<p>SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR</p>

<p>Mouse monoclonal Ficolin H antibody (Biotin)</p>

<p>Rabbit polyclonal BIM antibody (Ser59)</p>

<p>Armenian Hamster monoclonal gamma delta TCR antibody (allophycocyanin)</p>

<p>Rabbit polyclonal GSDMC antibody</p>

<p>INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK</p>

<p>The mTOR antibody is a monoclonal antibody that has an inhibitory effect on the mammalian target of rapamycin (mTOR). It is widely used in the industrial and research fields, particularly in Life Sciences. The mTOR antibody works by binding to mTOR and preventing its activation, thereby inhibiting its downstream signaling pathways. This antibody has been extensively studied and characterized using various techniques such as molecular modeling, phosphatase assays, and molecular docking. It is also being explored for its potential as an antidiabetic agent. The mTOR antibody can be immobilized for use in various applications, including diagnostic assays and therapeutic development. With its high specificity and affinity, this monoclonal antibody is a valuable tool for studying the role of mTOR in cellular processes and developing targeted inhibitors.</p>

<p>IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA</p>

<p>Rabbit polyclonal Caspase 2 antibody (Ser157)</p>

<p>The TNFRSF4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize chemokines that are activated during viral infections. This antibody has been extensively tested and proven to have antiviral properties, effectively neutralizing virus surface antigens and preventing viral replication.</p>

<p>Rabbit polyclonal SAMD4B antibody</p>

<p>FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>CAPSL antibody was raised in Rabbit using Human CAPSL as the immunogen</p>

<p>IL1A antibody was raised in Rabbit using Human IL1A as the immunogen</p>

<p>Purified Rabbit polyclonal OR13D1 antibody</p>

<p>The MAK antibody is a polyclonal antibody that specifically targets insulin. It is commonly used in research and diagnostic applications to detect and quantify insulin levels in biological samples. The MAK antibody is highly reactive and exhibits high affinity towards insulin, making it an ideal tool for various immunological assays. This antibody can be conjugated with different enzymes such as alkaline phosphatases or horseradish peroxidase, allowing for easy detection of insulin in immunoassays. Additionally, the MAK antibody can be used in combination with other antibodies or binding moieties to develop multiplex assays for the simultaneous detection of multiple analytes. Its versatility and specificity make the MAK antibody a valuable tool in the field of biomedical research and clinical diagnostics.</p>

<p>ANKRD13B antibody was raised using the middle region of ANKRD13B corresponding to a region with amino acids HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ</p>

<p>Rabbit polyclonal PYK2 antibody (Tyr881)</p>

<p>Rabbit polyclonal LN28A antibody</p>

<p>Rabbit polyclonal SYNPO2L antibody</p>

<p>The AK1 antibody is a highly specialized monoclonal antibody that targets the amino group in nuclear extracts. It has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of cancer cells. This antibody specifically targets interferon and growth factor receptors, making it a valuable tool for researchers studying these pathways. In addition, the AK1 antibody has been used in combination with other monoclonal antibodies such as trastuzumab to enhance their therapeutic effects. Its unique lysine-specific binding properties make it an ideal choice for various applications, including spectrometric analysis and electrode-based assays. Whether you are conducting research or developing new therapies, the AK1 antibody is a powerful tool that can help you achieve your goals.</p>

<p>Rabbit polyclonal UBR7 antibody</p>

<p>The PDLIM2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target and detect e-cadherin expression, a protein involved in cell adhesion and signaling. This antibody is ideal for researchers and scientists working on projects related to e-cadherin, as it allows for precise detection and analysis.</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>The BRDU antibody is a highly effective medicament that belongs to the class of activated monoclonal antibodies. It specifically targets the nuclear glycoprotein, e-cadherin, and inhibits its expression. This antibody is widely used in Life Sciences for various biochemical studies and research purposes. It is commonly employed in experiments involving the detection and quantification of cell proliferation and DNA synthesis. The BRDU antibody is a valuable tool for scientists and researchers working in fields such as cancer biology, immunology, and developmental biology. With its exceptional specificity and reliability, this monoclonal antibody is an essential component of any laboratory's toolkit.</p>

<p>The SUFU antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists working in various applications such as flow immunoassays, electrochemical impedance, and crystal microbalance studies. This antibody is available in both monoclonal and polyclonal forms, providing flexibility and options for different experimental needs.</p>

Rabbit polyclonal ZNF395 antibody

<p>CD86 antibody was raised in Mouse using a purified recombinant fragment of human CD86 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal WEE1 antibody (Ser53)</p>

<p>Rabbit polyclonal PUS3 antibody</p>

<p>Akt, also called Protein Kinase B (PKB), is a serine/threonine-specific protein kinase crucial for regulating cellular functions such as growth, survival, metabolism, and proliferation. It serves as a central component in the PI3K/Akt/mTOR pathway, integrating signals required for cellular adaptation and function. Humans express three primary isoforms of Akt—Akt1, Akt2, and Akt3—each encoded by different genes. Activation of Akt starts when external signals, like growth factors or insulin, bind to cell surface receptors, which then activate phosphoinositide 3-kinase (PI3K). This cascade leads to the formation of PIP3 on the cell membrane, recruiting Akt to undergo two key phosphorylation events at Thr308 and Ser473. Once activated, Akt can travel within the cell to phosphorylate target proteins.The main functions of Akt include enhancing cell survival by blocking apoptosis through the inactivation of pro-apoptotic proteins such as BAD and Caspase-9, and promoting cell growth and proliferation by activating mTOR, a critical regulator of protein synthesis. Akt also plays a central role in metabolism, boosting glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, which is especially important in muscle and fat tissues. Additionally, Akt facilitates angiogenesis by upregulating VEGF, supporting tissue repair, and enhances cell migration, assisting in wound healing but also enabling the spread of cancer cells. Given its broad role in supporting cell growth and survival, Akt is frequently hyperactivated in cancers, fueling unchecked cell division and tumor development, which makes it a target in cancer treatments. Furthermore, Akt’s role in glucose metabolism connects it to insulin signaling, where pathway disruptions can lead to impaired glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>Rabbit polyclonal USP3 antibody</p>

<p>C4BPB antibody was raised in Rabbit using Human C4BPB as the immunogen</p>

<p>The NUP98 antibody is a highly specific monoclonal antibody that targets the NUP98 protein. This protein is involved in various cellular processes, including polypeptide expression and regulation of gene expression. It has been shown to play a role in hyperpolarization-activated non-alcoholic steatohepatitis (NASH) and is expressed in microvessel endothelial cells.</p>

<p>Rabbit polyclonal TBRG1 antibody</p>

<p>Mouse monoclonal V beta 13.2 TCR antibody (PE)</p>

<p>Rabbit polyclonal RIPK2 antibody (Ser176)</p>

<p>Rabbit polyclonal KLHL29 antibody</p>

<p>Mouse monoclonal ERCC4 antibody</p>

<p>CCDC50 antibody was raised using the middle region of CCDC50 corresponding to a region with amino acids GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV</p>

<p>TBC1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that is used in immunoassays and research applications. It is designed to target and bind to the DGKA protein, which plays a crucial role in various biological processes. This antibody can be used for the detection and quantification of DGKA in samples, making it an essential tool for researchers in the Life Sciences field.</p>

<p>Rabbit Polyclonal ETFDH antibody</p>

<p>The PABP antibody is a highly specific and versatile tool used in Life Sciences research. It is designed to target and bind to the poly(A) binding proteins (PABPs), which play a crucial role in mRNA stability, translation, and other cellular processes. This antibody can be used for various applications such as immunoprecipitation, Western blotting, immunofluorescence, and flow cytometry.</p>

<p>Mouse monoclonal MGRN1 antibody</p>

<p>Desmin antibody is a monoclonal antibody that specifically targets and binds to desmin, a protein involved in cell growth and maintenance. Desmin antibody has been widely used in research and diagnostics to study various cellular processes, including epidermal growth factor signaling, nuclear localization, and tyrosine phosphorylation. It is also commonly used as a primary antibody in immunohistochemistry and Western blotting experiments. Additionally, desmin antibody has shown potential therapeutic applications as an anti-HER2 antibody-drug conjugate, in combination with other antibodies such as trastuzumab. Its use as a research tool has provided valuable insights into the role of desmin in diseases such as cancer, fatty acid metabolism disorders, c-myc overexpression, and neurodegenerative disorders involving alpha-synuclein aggregation.</p>

<p>Rabbit polyclonal NFAT5 antibody (Ser1197)</p>

<p>CARD9 antibody was raised in Rabbit using Human CARD9 as the immunogen</p>

<p>Rabbit polyclonal ROPN1L antibody</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>The Smad2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets alpha-fetoprotein and alpha-synuclein, two important proteins involved in various cellular processes. This antibody is commonly used in research studies to investigate the role of these proteins in different diseases and conditions.</p>

<p>SLC41A2 antibody was raised using the N terminal of SLC41A2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK</p>

<p>The MYBL2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the nuclear protein MYBL2, which plays a crucial role in cell growth and division. MYBL2 is known to interact with various factors such as epidermal growth factor (EGF) and tumor necrosis factor-alpha (TNF-α), regulating important cellular processes.</p>

<p>The TBLR1 antibody is a monoclonal antibody that belongs to the class of chemokine antibodies. It is widely used in the field of Life Sciences for various research applications. This antibody specifically targets TBLR1, which is a protein involved in several cellular processes. It has been shown to interact with vasoactive intestinal peptide (VIP), an important regulator of immune responses and inflammation. The TBLR1 antibody has also been found to inhibit the activity of egf-like proteins, which play a crucial role in cell growth and development. Furthermore, this antibody has high affinity for human serum albumin, making it an ideal tool for studying protein-protein interactions and drug delivery systems. Its inhibitory effect on family kinases and interleukin-6 further enhances its potential therapeutic applications.</p>

<p>Rabbit polyclonal SF3A2 antibody</p>

<p>Rabbit polyclonal SNRPN antibody</p>

<p>The BLNK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of glucokinase, a key enzyme involved in glucose metabolism. This antibody shows great potential as a therapeutic agent for various conditions, including diabetes and metabolic disorders.</p>

<p>CD138 antibody is a monoclonal antibody used in the field of Life Sciences. It is known for its antiviral properties and its ability to target specific molecules in the body. This antibody specifically binds to CD138, a glycoprotein that is expressed on the surface of activated plasma cells. By binding to CD138, this antibody can inhibit the activity of phosphatases and chemokines, which play important roles in immune responses. Additionally, CD138 antibody has neutralizing effects on certain viruses and can be used in immunoassays to detect the presence of specific antigens in human serum. With its high specificity and effectiveness, CD138 antibody is a valuable tool in research and diagnostic applications within the field of Life Sciences.</p>

<p>The GPR180 antibody is a highly specialized monoclonal antibody that targets the G protein-coupled receptor 180 (GPR180). This antibody has been developed for use in Life Sciences research and is widely used in various assays and experiments. The GPR180 antibody specifically binds to the GPR180 antigen, neutralizing its activity and preventing downstream signaling events.</p>

<p>The JAK3 antibody is a monoclonal antibody that specifically targets the activated form of the JAK3 protein. This antibody is commonly used in research and diagnostic applications to detect and quantify the presence of JAK3 in human serum samples. The JAK3 antibody can be immobilized on an electrode or colloidal surface to create a sensitive and specific assay for detecting JAK3 levels. It is also used in studies investigating growth factors, autoantibodies, and collagen-related diseases. The high specificity and affinity of this monoclonal antibody make it an essential tool for researchers studying helicobacter infections and other diseases involving the JAK3 pathway. Additionally, the JAK3 antibody can be used in combination with other antibodies, such as polyclonal antibodies, to enhance detection sensitivity and accuracy.</p>

<p>RNPC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA</p>

<p>RSV antibody (FITC) was raised in mouse using nucleoprotein of RSV as the immunogen.</p>

<p>The BIP antibody is a monoclonal antibody that specifically targets and neutralizes the activity of BIP (Binding Immunoglobulin Protein). This protein plays a crucial role in various cellular processes, including protein folding and quality control. The BIP antibody is derived from globulin and is produced using advanced biotechnological methods.</p>

<p>Rabbit polyclonal TLP3 antibody</p>

<p>Rabbit polyclonal M3KR10 antibody</p>

<p>The BCR antibody is a polyclonal antibody that targets the B-cell receptor (BCR), a protein involved in the regulation of immune responses. It specifically recognizes and binds to the epitopes present on the BCR, allowing for the detection and analysis of B-cell activity. This antibody has been widely used in various life sciences research applications, including immunohistochemistry, flow cytometry, and western blotting. Additionally, it has shown potential therapeutic applications in the treatment of autoimmune diseases and certain types of cancer. With its high specificity and sensitivity, the BCR antibody is an essential tool for researchers studying B-cell biology and related fields.</p>

<p>MESDC2 antibody was raised in Rabbit using Human MESDC2 as the immunogen</p>

<p>The ATF2 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It is specifically designed to target and bind to ATF2, a protein that plays a crucial role in various cellular processes. This antibody is commonly used in research studies to investigate the function and regulation of ATF2.</p>

<p>Mouse monoclonal C20orf3 antibody</p>

<p>Alpha-1 antichymotrypsin antibody was raised in mouse using affinity purified alpha-1 antichymotrypsin as the immunogen.</p>

<p>Rat monoclonal CD45R antibody (biotin)</p>

<p>SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL</p>

<p>The IKB alpha antibody is a growth factor monoclonal antibody that specifically targets and binds to the IKB alpha protein. This protein plays a crucial role in regulating the activity of NF-kappaB, a transcription factor involved in various cellular processes such as inflammation, immune response, and cell survival. By binding to IKB alpha, this antibody prevents its degradation and inhibits the activation of NF-kappaB.</p>

<p>LEP antibody was raised in Rabbit using Human LEP as the immunogen</p>

<p>Mouse monoclonal GBP2 antibody</p>

<p>BAD antibody is a polyclonal antibody that targets the BAD protein, which plays a crucial role in regulating apoptosis (cell death) in adipose tissue. This antibody can be used as an inhibitor to study the function of BAD in adipocytes and other cell types. Additionally, it can be used as a research tool in the field of life sciences to investigate the mechanisms underlying cell death and survival. The BAD antibody is available as both polyclonal and monoclonal antibodies, offering researchers different options based on their specific needs. It has been shown to have neutralizing effects on the activity of BAD, making it a valuable tool for studying its function in various cellular processes.</p>

<p>The PDGFR alpha antibody is a highly effective inhibitor that belongs to the class of polypeptides and monoclonal antibodies. It specifically targets the extracellular region of the PDGFR alpha protein, inhibiting its activity. This antibody has been extensively studied in Life Sciences and has shown remarkable efficacy in inhibiting the growth and proliferation of cells expressing PDGFR alpha. It binds to specific epitopes on the protein, preventing its interaction with ligands and downstream signaling pathways. The synthetic nature of this antibody ensures high specificity and potency, making it an ideal choice for research and therapeutic applications. Whether you are studying cellular processes or developing novel treatments, this PDGFR alpha antibody will provide reliable results and contribute to advancements in the field. Choose this antibody for its exceptional inhibiting properties and join the scientific community in unraveling the mysteries of cellular biology.</p>

<p>Rabbit polyclonal SLC37A4 antibody</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL</p>

<p>RDM1 antibody was raised using the middle region of RDM1 corresponding to a region with amino acids NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF</p>

<p>DHX8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP</p>

<p>Mouse monoclonal SulT2A1 antibody</p>

<p>Mouse monoclonal SERPINB6 antibody</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr133)</p>

LACTB antibody was raised in Rabbit using Human LACTB as the immunogen

KRT80 antibody was raised in Rabbit using Human KRT80 as the immunogen

<p>Mouse monoclonal CD15 antibody (biotin)</p>

<p>LGALS3BP antibody was raised in Rabbit using Human LGALS3BP as the immunogen</p>

<p>Rabbit Polyclonal OR6A2 antibody</p>

<p>TPTE antibody is a polyclonal antibody that specifically targets the TPTE protein. This protein is involved in various cellular processes, including the regulation of fibrinogen, transferrin, epidermal growth factor, and TNF-α. The TPTE antibody can be used in life sciences research to study the functions and interactions of these biomolecules. Additionally, this antibody has been shown to have inhibitory effects on the activation of necrosis factor-related apoptosis-inducing ligand (TRAIL), making it a potential therapeutic target for anti-cancer treatments. The TPTE antibody can also be used in combination with other antibodies, such as anti-HER2 antibody trastuzumab, to enhance their efficacy. Its specificity and high affinity make it a valuable tool for studying TPTE-related pathways and investigating potential therapeutic interventions.</p>

<p>The E Cadherin antibody is a highly reactive monoclonal antibody that specifically targets the E-cadherin protein. This antibody is widely used in Life Sciences research to study various biological processes and interactions. E-cadherin plays a crucial role in cell adhesion and is involved in maintaining tissue integrity. The E Cadherin antibody binds to the amino group of the target molecule, allowing for the detection and analysis of E-cadherin expression levels in different cell types and tissues.</p>

<p>UBE2S antibody was raised using the N terminal of UBE2S corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE</p>

<p>Mouse monoclonal Bt Cry1Ab/Ac antibody</p>

<p>Rabbit polyclonal cJun antibody (Ser63)</p>

<p>Rabbit polyclonal TIGD1 antibody</p>

<p>The cMaf antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that targets the protein cMaf, which plays a crucial role in various biological processes. This antibody is widely used in research and diagnostic applications.</p>

<p>MRPL21 antibody was raised in Rabbit using Human MRPL21 as the immunogen</p>

<p>The CD180 antibody is a monoclonal antibody that acts as a neutralizing agent against autoantibodies. It targets the growth factor CD180 and inhibits its activity, preventing the harmful effects of autoantibodies. This antibody has been shown to inhibit the activation of caspase-9 and GAPDH, two proteins involved in cell death processes. Additionally, it has been found to have cytotoxic effects on adipocytes, suggesting its potential use in obesity-related disorders. The CD180 antibody also shows promise in the field of life sciences, with applications in research related to hormones such as glucagon and dopamine.</p>

<p>The SOX9 antibody is a highly specialized antibody that targets extracellular histones and growth factor binding proteins. It has been shown to have antiviral properties and can effectively inhibit the growth of HL-60 cells. This antibody is a glycoprotein that can also be used as an autoantibody for diagnostic purposes. The SOX9 antibody is part of a collection of polyclonal antibodies that are widely used in life sciences research. In addition to its antiviral properties, this antibody has also shown promise as an anticancer agent due to its ability to modulate chemokine signaling pathways. Its multidrug reactive nature makes it a valuable tool in various research applications within the field of Life Sciences.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>CAPN6 antibody was raised in Rabbit using Human CAPN6 as the immunogen</p>

<p>Purified Polyclonal Inhibin beta A antibody</p>

<p>Mouse monoclonal FSHB antibody</p>

<p>Rat monoclonal CD8 antibody (PE); IgG2b kappa</p>

<p>RNF2 antibody was raised in Rabbit using Human RNF2 as the immunogen</p>

<p>CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface protein involved in various immune responses. This antibody has been shown to neutralize the activity of CD11b and inhibit its function in immune cells. CD11b antibody has been used in research studies to investigate the role of CD11b in different biological processes, including hepcidin regulation, interleukin-6 signaling, and syncytia formation. It has also been shown to modulate intracellular signaling pathways such as the p38 MAPK pathway and protein kinases. This antibody is widely used in life sciences research for its ability to selectively bind and block CD11b activity, making it a valuable tool for studying immune responses and developing potential therapeutic interventions.</p>

PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa731-909) expressed in E. coli as the immunogen.

<p>Mouse monoclonal 160 kDa Neurofilament antibody</p>

<p>The PLOD2 antibody is a highly advanced and specialized product in the field of Life Sciences. It belongs to the category of antibodies and is known for its high-flux inhibitory properties. This antibody is widely used as a serum marker and has been extensively studied as an interferon-stimulated gene. The PLOD2 antibody is designed to specifically target and bind to PLOD2, which is an important enzyme involved in collagen synthesis.</p>

<p>HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA</p>

<p>Rabbit polyclonal RBM26 antibody</p>

<p>TNPO3 antibody was raised in mouse using recombinant Human Transportin 3 (Tnpo3)</p>

<p>Mouse monoclonal NIF3L1 antibody</p>

<p>MID2 antibody was raised in Rabbit using Human MID2 as the immunogen</p>

<p>HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV</p>

<p>The STK3 antibody is a polyclonal antibody that targets the protein kinase STK3. This antibody is commonly used in Life Sciences research to study the role of STK3 in various cellular processes. STK3, also known as 3-kinase, is involved in the regulation of cell growth, proliferation, and apoptosis. It forms a protein complex with other molecules and acts as a critical signaling mediator. The STK3 antibody specifically recognizes and binds to STK3, allowing researchers to detect its presence and measure its activity levels. This antibody is highly specific and sensitive, making it an essential tool for studying the function of STK3 in different experimental systems. Whether you are investigating the role of STK3 in cancer development or exploring its involvement in signal transduction pathways, the STK3 antibody will provide valuable insights into your research.</p>

<p>MCTP2 antibody was raised in Rabbit using Human MCTP2 as the immunogen</p>