Primary Antibodies

<p>GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT</p>

<p>MAPK11 antibody was raised in Mouse using a purified recombinant fragment of MAPK11 (aa251-363) expressed in E. coli as the immunogen.</p>

<p>SLC13A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL</p>

<p>Mouse monoclonal TUBA8 antibody</p>

The S100A10 antibody is a reactive monoclonal antibody that targets the glycoprotein S100A10. This antibody has been extensively studied in the field of Life Sciences and has been shown to have various functions. It is involved in hepatocyte growth and plays a role in the regulation of mesenchymal stem cells. The S100A10 antibody specifically binds to subtilisin/kexin type binding proteins and can be used for immobilization experiments or as a tool for studying protein-protein interactions. Additionally, this antibody has cytotoxic and neutralizing effects, making it a valuable tool for research purposes. Whether you need polyclonal antibodies or monoclonal antibodies, the S100A10 antibody is an excellent choice for your experiments.

Methadone antibody was raised in mouse using methadone as the immunogen.

<p>CADPS antibody was raised in Rabbit using Human CADPS as the immunogen</p>

<p>CRYAB antibody was raised in Mouse using a purified recombinant fragment of CRYAB(aa1-175) expressed in E. coli as the immunogen.</p>

<p>The PCIF1 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the glycoprotein PCIF1, which is found in neonatal serum and human serum. This antibody has been shown to have activated properties, making it highly effective in detecting and neutralizing autoantibodies, including antiphospholipid antibodies. The PCIF1 antibody works by binding to specific sites on the glycoprotein, preventing its interaction with other molecules and inhibiting its function. Its high specificity and affinity for PCIF1 make it a valuable tool for researchers studying autoimmune disorders and related conditions. With its ability to neutralize PCIF1, this monoclonal antibody offers promising potential for diagnostic applications and therapeutic interventions.</p>

<p>The DDOST antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to DDOST, a glycoprotein that plays a crucial role in protein glycosylation. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>CDC37 antibody was raised in Rabbit using Human CDC37 as the immunogen</p>

<p>IFT52 antibody was raised in Rabbit using Human IFT52 as the immunogen</p>

<p>UNQ1887 antibody was raised using the middle region of UNQ1887 corresponding to a region with amino acids VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF</p>

<p>Rabbit polyclonal GABRA6 antibody</p>

<p>Mouse monoclonal CD182 antibody</p>

<p>RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS</p>

<p>Rabbit polyclonal ATP6E antibody (FITC)</p>

<p>Purified Polyclonal 6PGL antibody</p>

<p>RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA</p>

<p>Purified Polyclonal RRAS2 antibody</p>

<p>Rabbit polyclonal TWF1 antibody</p>

<p>Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal CPLA2 antibody (Ser505)</p>

<p>PSMA antibody was raised in mouse using recombinant human PSMA (117-351aa) purified from E. coli as the immunogen.</p>

<p>ACAD10 antibody was raised in Rabbit using Human ACAD10 as the immunogen</p>

<p>Rabbit polyclonal CDK11A antibody</p>

<p>S6K1 antibody is a highly specific and potent phosphatase that plays a crucial role in various cellular processes. It contains a cycloalkyl group that allows for activation and binding to its target. This antibody has been extensively studied and proven to be effective in detecting and quantifying S6K1 levels in biological samples.</p>

<p>Guinea pig polyclonal Prealbumin antibody (HRP)</p>

<p>The EPS8L2 antibody is a specific antibody that targets the EPS8-like 2 protein. This protein is involved in various cellular processes, including dopamine signaling and phosphatase activity. The EPS8L2 antibody is commonly used in life sciences research, particularly in studies related to fetal hemoglobin and pluripotent stem cells. It can be used in assays to detect and quantify EPS8L2 protein levels in different samples. Additionally, this antibody has potential applications in the development of new medicines, as it may serve as a therapeutic target for certain diseases. Its binding properties make it suitable for use in adeno-associated virus-mediated gene delivery or as a tool to study G-protein-coupled receptor inhibitors. The EPS8L2 antibody is highly specific and recognizes specific epitopes on the EPS8L2 protein, making it an essential tool for researchers in the field of molecular biology and biochemistry.</p>

<p>PLAU antibody is a monoclonal antibody that targets the growth factor PLAU. It specifically binds to PLAU and inhibits its activity, leading to a decrease in cell proliferation and migration. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and ELISA. The antigen-antibody reaction between PLAU and the antibody is highly specific and sensitive, making it a valuable tool for research in the field of life sciences. Additionally, this antibody has been shown to have potential therapeutic applications in the treatment of diseases such as cancer and cardiovascular disorders.</p>

<p>NFKBIA antibody was raised in rabbit using the N terminal of NFKBIA as the immunogen</p>

<p>Benzodiazepine antibody was raised in mouse using benzodiazepine-BSA as the immunogen.</p>

<p>LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL</p>

<p>LOC342293 antibody was raised using the N terminal of LOC342293 corresponding to a region with amino acids PQIGLYVNKCLNSLELESHAARLINTYSEGNKRRLSTAIALMGRSSVIFL</p>

<p>Purified Polyclonal ARMC6 antibody</p>

<p>Rabbit Polyclonal HDAC2 antibody (Ser394)</p>

<p>GATA1 antibody was raised in Mouse using a purified recombinant fragment of human GATA1 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>Rabbit polyclonal ATF1 antibody (Ser63)</p>

<p>ACE2 antibody was raised in Rabbit using Human ACE2 as the immunogen</p>

<p>Mouse monoclonal GABPB2 antibody</p>

<p>KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK</p>

<p>The HDAC6 antibody is a highly effective medicament that targets adipose tissues and adipocytes. This monoclonal antibody specifically binds to glial fibrillary acidic protein, neutralizing its receptor binding capabilities. By doing so, it prevents the activation of reactive fatty acids and inhibits the formation of activated adipocytes. Additionally, this antibody has shown promising results in reducing glial fibrillary acidic protein levels in various life science studies. With its anti-glial fibrillary properties, the HDAC6 antibody holds great potential in the field of adipose research and therapeutic applications.</p>

<p>The CYP17A1 antibody is a highly specialized monoclonal antibody that targets the CYP17A1 enzyme. This enzyme plays a crucial role in the biosynthesis of fatty acids and lipoprotein lipase, making it an important target for therapeutic interventions. The CYP17A1 antibody has been extensively studied in various research fields, including Life Sciences, where it has shown promising results as a potential growth factor inhibitor.</p>

<p>Rabbit polyclonal SERPINB5 antibody</p>

<p>Rabbit polyclonal Keratin 17 antibody</p>

<p>Rabbit polyclonal Caspase 7 antibody (FITC)</p>

<p>The CDX2 antibody is a polyclonal antibody that is commonly used in Life Sciences research. It is highly specific and has been extensively validated for various applications. This antibody targets the CDX2 protein, which plays a crucial role in regulating gene expression and cell differentiation.</p>

<p>The CCL2 antibody is a monoclonal antibody that specifically targets the chemokine CCL2. This antibody is designed to bind to CCL2, preventing its interaction with its receptor and inhibiting its activity. It can be used in various research applications, including immunoassays, western blotting, and immunohistochemistry.</p>

<p>GRPEL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL</p>

<p>Mouse monoclonal CST4 antibody</p>

<p>The HES1 antibody is a medicinal composition that is designed to inhibit the activity of the HES1 gene in pluripotent stem cells. This antibody specifically targets and binds to the nucleic acids associated with the HES1 gene, preventing its expression and function. By inhibiting HES1, this antibody can regulate the differentiation and self-renewal of pluripotent stem cells, making it a valuable tool in Life Sciences research. The HES1 antibody is a monoclonal antibody, which means it is highly specific and effective in inhibiting the activity of HES1. It acts as an inhibitor, blocking the interaction between HES1 and its inducer molecules, thereby inhibiting the pluripotent stem cell's ability to differentiate into specific cell types. This inhibitor comes in various forms such as tautomers or solvates, allowing for flexibility in experimental design and application. With its potent inhibitory properties, the HES1 antibody is an essential substance for researchers working</p>

<p>PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR</p>

<p>Estrogen-Related Receptor Gamma antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML</p>

AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

<p>RNF40 antibody was raised using the C terminal of RNF40 corresponding to a region with amino acids KLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQGSLGGVEKELT</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, effectively inhibiting bacterial growth. Extensive research has shown its high efficacy through the use of advanced techniques such as the patch-clamp technique on human erythrocytes.</p>

<p>The alpha beta TcR antibody is a monoclonal antibody that specifically targets the alpha beta T-cell receptor (TcR). This antibody is widely used in Life Sciences research to study T-cell biology and function. It can be used to detect and quantify T-cells expressing the alpha beta TcR, as well as to investigate the interaction between T-cells and their target molecules.</p>

<p>CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL</p>

<p>Mouse monoclonal SORD antibody</p>

<p>DHX29 antibody was raised in Rabbit using Human DHX29 as the immunogen</p>

<p>Rabbit polyclonal Neuroglobin antibody (HRP)</p>

<p>NCALD antibody was raised in Rabbit using Human NCALD as the immunogen</p>

<p>FAM29A antibody was raised in Rabbit using Human FAM29A as the immunogen</p>

<p>The MMP10 antibody is a specific antibody used in Life Sciences research. It targets the matrix metalloproteinase 10 (MMP10), which is an enzyme involved in the breakdown of extracellular matrix components. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The MMP10 antibody has been shown to inhibit the activity of MMP10, thereby preventing the degradation of collagen and other extracellular matrix proteins. This inhibition has potential therapeutic implications for diseases such as arthritis and cancer. Additionally, this antibody can be used in studies involving pluripotent stem cells, as MMP10 plays a role in their differentiation and migration. Overall, the MMP10 antibody is a valuable tool for researchers studying protein-coupled signaling pathways and investigating the role of MMP10 in various biological processes.</p>

<p>FZR1 antibody was raised in Rabbit using Human FZR1 as the immunogen</p>

<p>Rabbit polyclonal KOR1 antibody (Ser369)</p>

<p>Rabbit polyclonal SEPT1 antibody</p>

<p>DNAJC1 antibody was raised in Rabbit using Human DNAJC1 as the immunogen</p>

<p>SLC9A3R2 Monoclonal Antibody</p>

<p>Affinity purified Rabbit polyclonal MIP1 beta antibody</p>

<p>USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids  CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS</p>

<p>ATP4B antibody was raised in Rabbit using Human ATP4B as the immunogen</p>

<p>The IL3 antibody is a receptor molecule that has neutralizing properties. It is commonly used in hybridization and antibody-related research in the Life Sciences field. This antibody specifically targets interleukin-3 (IL-3), a cytokine that plays a crucial role in the production and differentiation of various blood cells. By binding to IL-3, the IL3 antibody can effectively block its activity, making it an essential tool for studying the function and regulation of IL-3.</p>

<p>The JAK2 antibody is a monoclonal antibody that specifically targets the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in cell signaling and is involved in various biological processes, including chemokine signaling, epidermal growth factor receptor activation, and collagen synthesis.</p>

<p>Affinity purified Rabbit polyclonal B-Catenin antibody</p>

<p>FXN antibody was raised in Rabbit using Human FXN as the immunogen</p>

<p>Rabbit polyclonal PMP2 antibody</p>

<p>Purified Rabbit polyclonal MADS34 antibody</p>

<p>The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.</p>

<p>CD16 antibody was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>Rabbit polyclonal Thrombospondin antibody (HRP)</p>

<p>KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI</p>

<p>C6ORF182 antibody was raised using the middle region of C6Orf182 corresponding to a region with amino acids DIECELECLLKKMEIKGEQISKLKKHQDSVCKLQQKVQNSKMSEASGIQQ</p>

TNF alpha antibody was raised in Mouse using recombinant Human TNF-alpha (BioSource company, Cat.No. PHC3013) as the immunogen.

<p>Rabbit polyclonal TNAP3 antibody</p>

<p>Purified Rabbit polyclonal OR56A1 antibody</p>

<p>The PICP antibody is a highly specialized monoclonal antibody that targets the calpastatin protein. Calpastatin is an important regulator of calpain, a calcium-dependent protease involved in various cellular processes. The PICP antibody specifically inhibits the activity of calpastatin, thereby allowing for the activation of calpain.</p>

<p>The ACO2 antibody is a monoclonal antibody that has been widely used in the field of Life Sciences. It has shown great potential in various applications, including the wst-1 assay, transcription-polymerase chain reaction (PCR), and immunocytochemical techniques.</p>

<p>EIF1AY antibody was raised in Rabbit using Human EIF1AY as the immunogen</p>

<p>Purified Polyclonal CTDSP1 antibody</p>

<p>YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY</p>

<p>The BRAF antibody is a neuroprotective globulin that belongs to the class of glycosylated monoclonal antibodies. It has been specifically designed to target and inhibit the activity of BRAF, a protein involved in various cellular processes. This antibody has shown inhibitory effects on factors such as alpha-fetoprotein and chemokines, making it a valuable tool for researchers in the field of Life Sciences. The BRAF antibody is available in both polyclonal and monoclonal forms, providing options for different experimental needs. It is formulated with excipients to ensure stability and efficacy. Additionally, this antibody has neutralizing properties against IFN-gamma, further expanding its potential applications. With its unique characteristics and versatile nature, the BRAF antibody offers promising opportunities for scientific investigations and therapeutic developments.</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>Rabbit polyclonal Bcl-xL antibody</p>

<p>NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA</p>

<p>The CDKN2A antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets the glycoprotein CDKN2A. This antibody has been extensively studied and proven to effectively inhibit the activity of CDKN2A, making it a valuable tool for researchers working in various areas of biology and medicine.</p>

<p>The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.</p>

<p>Rabbit polyclonal CCL24 antibody (biotin)</p>

<p>Affinity purified Rabbit polyclonal B5R1 antibody</p>

<p>Rabbit polyclonal OR4K14 antibody</p>

<p>Purified Polyclonal CBP86 antibody</p>

<p>APOBEC2 antibody was raised in Rabbit using Human APOBEC2 as the immunogen</p>

<p>Rabbit Polyclonal BAD antibody (Ser136)</p>

<p>The Mitofilin antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers studying various aspects of cellular function, particularly related to fatty acid metabolism and energy production. This monoclonal antibody specifically targets Mitofilin, a protein found in the inner mitochondrial membrane.</p>

<p>Rabbit Polyclonal IRS1 antibody (Ser312)</p>

<p>JAK3 antibody was raised in Mouse using a purified recombinant fragment of human JAK3 expressed in E. coli as the immunogen.</p>

<p>DTX3L antibody was raised in Rabbit using Human DTX3L as the immunogen</p>

<p>AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET</p>

<p>Purified Rabbit polyclonal ABCF2 antibody</p>

<p>POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL</p>

<p>DEFB4A antibody was raised in rabbit using the N terminal of DEFB4A as the immunogen</p>

<p>Purified Polyclonal HSD11B1 antibody</p>

<p>INPP5D antibody was raised in rabbit using the C terminal of INPP5D as the immunogen</p>

<p>LYZ antibody was raised in rabbit using the N terminal of LYZ as the immunogen</p>

<p>Mouse monoclonal FLYWCH2 antibody</p>

<p>The CTBP1 antibody is a polyclonal antibody that is used in Life Sciences research. It has a high affinity for the low-density lipoprotein receptor-related protein 1 (LRP1) and can be used to study its role in various cellular processes. The CTBP1 antibody has been shown to inhibit the binding of epidermal growth factor (EGF) to LRP1, suggesting that it may play a role in EGF signaling pathways. Additionally, this antibody has been used to detect autoantibodies against CTBP1 in patients with certain autoimmune diseases. The CTBP1 antibody can be used in various techniques such as immunohistochemistry, western blotting, and ELISA to detect and quantify CTBP1 expression levels. Its specificity and sensitivity make it an ideal tool for researchers studying the function of CTBP1 and its potential as a therapeutic target.</p>

<p>PPP1R3B antibody was raised in rabbit using the N terminal of PPP1R3B as the immunogen</p>

<p>The OTX2 antibody is a monoclonal antibody that specifically targets and binds to the OTX2 protein. This protein plays a crucial role in regulating gene expression and development in various tissues, including the brain and eyes. The OTX2 antibody can be used for research purposes in the field of Life Sciences to study the function and localization of OTX2 in different cell types.</p>

<p>FAM47A antibody was raised using the middle region of FAM47A corresponding to a region with amino acids SEPPKTRRTSSLRSEPPKTRRTSSLGPEPPKTRRVSSLRPELPKSRRVSS</p>

<p>WWOX antibody was raised in rabbit using the C terminal of WWOX as the immunogen</p>

<p>MYL3 antibody was raised using the N terminal of MYL3 corresponding to a region with amino acids VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG</p>

<p>DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL</p>

Rabbit polyclonal WDR68 antibody

<p>The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>Mad1 Monoclonal Antibody</p>

<p>Rabbit polyclonal ILF2 antibody (biotin)</p>

<p>Rabbit polyclonal GRB10 antibody</p>

<p>Rabbit polyclonal TLE2 antibody</p>

<p>The PKC zeta antibody is a polyclonal antibody that specifically reacts with the activated form of protein kinase C zeta (PKCζ). PKCζ is an endogenous protein kinase that plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. This antibody is widely used in Life Sciences research to study the function and regulation of PKCζ.</p>

<p>Rat monoclonal CD98 antibody (PE)</p>

<p>CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI</p>

<p>The MKK4 antibody is a polyclonal antibody that specifically targets the MKK4 protein. It is derived from porcine serum and has been extensively tested for its specificity and efficacy. The MKK4 antibody can be used in various life science applications, including Western blotting, immunohistochemistry, and ELISA. It has been shown to effectively detect the presence of MKK4 in samples and has minimal cross-reactivity with other proteins such as lipoprotein, myoglobin, albumin, and transferrin. This high-quality antibody is an essential tool for researchers studying the role of MKK4 in various cellular processes, including coagulation.</p>

<p>Rabbit polyclonal TPH2 antibody (Ser19)</p>

Rabbit polyclonal TTBK2 antibody

<p>CSK antibody is a monoclonal antibody that specifically targets influenza hemagglutinin, a glycoprotein found on the surface of the influenza virus. This antibody has neutralizing properties, meaning it can bind to and inhibit the activity of the virus, preventing its entry into host cells. CSK antibody is produced by hybridoma cells, which are created by fusing immune cells with myeloma cells. This allows for the production of large quantities of highly specific antibodies. CSK antibody can be used in various applications in life sciences research, including studying the role of hemagglutinin in viral infection and developing diagnostic tests for influenza. Its high specificity and affinity make it a valuable tool for researchers in the field.</p>

<p>Rabbit polyclonal TAS2R5 antibody</p>

<p>Mouse monoclonal PGAM2 antibody</p>

<p>DBR1 antibody was raised in Rabbit using Human DBR1 as the immunogen</p>

<p>Purified Polyclonal DUX5 antibody</p>

<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF</p>

<p>Affinity purified Rabbit polyclonal DNAI2 antibody</p>

<p>Human growth hormone antibody (HRP) was raised in mouse using human growth hormone as the immunogen.</p>

Mouse monoclonal LMAN1 antibody

<p>FBXO3 antibody was raised in Rabbit using Human FBXO3 as the immunogen</p>

<p>The SHH antibody is a monoclonal antibody that targets the Sonic Hedgehog (SHH) protein. This protein is involved in various cellular processes, including cell growth and differentiation. The SHH antibody specifically binds to the SHH protein, neutralizing its activity.</p>

<p>IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL</p>

<p>The GLUR1 antibody is a reactive antibody that specifically targets the IL-1 receptor, an important component of the interleukin signaling pathway. This antibody is widely used in Life Sciences research to study the role of IL-1 in various biological processes. Additionally, it has been shown to inhibit the production of pancreatic glucagon, a hormone involved in regulating blood sugar levels.</p>

<p>Rabbit polyclonal RPS18 antibody</p>

<p>ACHE antibody was raised in Rabbit using Human ACHE as the immunogen</p>

<p>The LCN2 antibody is a highly specialized antibody that targets sclerostin. It is available in both polyclonal and monoclonal forms, offering a wide range of options for researchers. The antibody has been shown to neutralize prorenin and inhibit glucose-6-phosphate activation, making it a valuable tool for studying these processes. Additionally, the LCN2 antibody can be used in various assays and experiments, thanks to its high specificity and affinity for the target antigen. Its activated colloidal gold conjugate allows for easy visualization and detection using techniques such as immunohistochemistry or Western blotting. Researchers can rely on the LCN2 antibody to provide accurate and reliable results in their studies.</p>

The TNFSF13B antibody is a monoclonal antibody that specifically targets transthyretin. It binds to transthyretin and prevents it from interacting with its binding proteins, thereby inhibiting its activity. This antibody has been shown to be effective in various applications, including electrode immobilization for the detection of transthyretin in human hepatocytes, as well as in research in the field of Life Sciences. Additionally, the TNFSF13B antibody can be used in combination with other antibodies, such as anti-glial fibrillary acidic protein (GFAP) antibodies, to study cytotoxic effects and cellular responses. Its high specificity and affinity make it a valuable tool for researchers working with transthyretin-related studies.

<p>Rabbit polyclonal GRK4 antibody</p>

<p>COMMD1 antibody was raised in rabbit using the C terminal of COMMD1 as the immunogen</p>

<p>The SIGLEC7 antibody is an inhibitory antibody that targets adeno-associated viruses. It is a polyclonal antibody that specifically binds to the SIGLEC7 receptor, which is expressed on various immune cells. This antibody has been shown to inhibit the activity of serotonin, a neurotransmitter involved in regulating mood and behavior. In addition, it can also bind to antigenic proteins and block their interaction with other molecules. The SIGLEC7 antibody has potential applications in life sciences research and the development of therapeutic antibodies for various diseases. It can be used as a tool to study the function of SIGLEC7 and its role in immune responses. Furthermore, this antibody may have clinical implications as a potential treatment for autoimmune disorders or as a targeted therapy for certain types of cancer.</p>

<p>The ID3 antibody is a highly specialized monoclonal antibody that targets alpha-synuclein, c-myc, and other activated proteins in the Life Sciences field. It has been extensively studied for its cytotoxic effects on cancer cells and has shown promising results in preclinical trials. The ID3 antibody is similar to trastuzumab, another monoclonal antibody used in the treatment of certain types of cancer. It works by binding to specific growth factors such as interleukin-6 and endothelial growth factor, inhibiting their activity and preventing tumor growth. Additionally, the ID3 antibody has been found to reduce viscosity in blood samples, making it a valuable tool for diagnostic purposes. Its potential applications extend beyond oncology, as it may also be useful in studying epidermal growth and other biological processes.</p>

<p>Rabbit polyclonal USP45 antibody</p>

<p>Rabbit polyclonal ECRG4 antibody</p>

The PPBP antibody is a highly specialized neutralizing monoclonal antibody. It belongs to the class of globulins and exhibits cytotoxic and cyclase-activating properties. This antibody is used for the detection and quantification of PPBP (Platelet Basic Protein) in various biological samples. It can be used in research applications, such as ELISA (Enzyme-Linked Immunosorbent Assay), immunohistochemistry, and Western blotting.

<p>Purified Polyclonal ARHGEF5 antibody</p>

<p>Mouse monoclonal SSR1 antibody</p>

<p>Rabbit polyclonal Collagen VII alpha 1 antibody</p>

<p>HPGD antibody was raised in rabbit using the N terminal of HPGD as the immunogen</p>

<p>COG6 antibody was raised in Rabbit using Human COG6 as the immunogen</p>

<p>Purified Rabbit polyclonal M3K-R22 antibody</p>

<p>Armenian Hamster monoclonal CD69 antibody (allophycocyanin)</p>

Rabbit polyclonal TAX1BP1 antibody

<p>GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV</p>

<p>Rabbit polyclonal SES1 antibody (HRP)</p>

<p>IGF1R antibody was raised in Mouse using a purified recombinant fragment of IGF1R expressed in E. coli as the immunogen.</p>

<p>AATF antibody was raised in Rabbit using Human AATF as the immunogen</p>

<p>UBE2D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE</p>

<p>Purified Rabbit polyclonal M3KE16 antibody</p>

<p>Nidogen/Enactin Monoclonal Antibody</p>

<p>RAB25 antibody was raised in Mouse using a purified recombinant fragment of RAB25 expressed in E. coli as the immunogen.</p>

<p>Rat monoclonal CD62L antibody (allophycocyanin)</p>

<p>Purified Polyclonal AMPK alpha 1/2 antibody</p>

<p>RP11-269F19.9 antibody was raised using the middle region of RP11-269F19.9 corresponding to a region with amino acids VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC</p>

<p>Rabbit polyclonal PDZD3 antibody</p>

<p>The CD49d Antibody is a highly effective monoclonal antibody that targets the CD49d protein, which is expressed in various cells including MCF-7 cells. This antibody has been extensively studied and proven to be an active agent in inhibiting the growth and proliferation of cancer cells. It works by binding to the CD49d protein on the cell surface and blocking its function, thereby preventing the activation of pathways involved in cell survival and growth.</p>

<p>MVD antibody was raised in rabbit using the N terminal of MVD as the immunogen</p>

The UBE3A antibody is a powerful tool in the field of biomedical research. It belongs to the class of polyclonal antibodies and is commonly used as an inhibitor for various proteins and hormones, including VEGF (vascular endothelial growth factor) and natriuretic peptides. This antibody can be used in both in vitro and in vivo studies to investigate the role of specific proteins in different biological processes.

<p>GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS</p>

<p>CASC3 antibody was raised using the N terminal of CASC3 corresponding to a region with amino acids MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPS</p>

<p>HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES</p>