Primary Antibodies

<p>Keratin hHa5 antibody was raised in guinea pig using a synthetic peptide of human hair (trichocytic) keratin hHa5 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal PKD mu antibody</p>

<p>Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>AKT1 antibody was raised in rabbit using the N terminal of AKT1 as the immunogen</p>

<p>Goat anti-mouse IgM (Fab'2) (PE) was raised in goat using murine IgM mu heavy chain as the immunogen.</p>

<p>TFPI antibody was raised in sheep using Synthetic peptide corresponding to NH-terminus of human TFPI conjugated to carrier as the immunogen.</p>

<p>ZNF527 antibody was raised in rabbit using the C terminal of ZNF527 as the immunogen</p>

<p>Sheep polyclonal Epi Demethyl Salvinorin antibody</p>

<p>AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti-human IgG (biotin) was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>Factor I antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>Purified Polyclonal Claudin 19 antibody</p>

<p>SLC5A3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit anti-mouse IgM (biotin) was raised in rabbit using murine IgM mu heavy chain as the immunogen.</p>

<p>basic hair keratin K86 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K86 coupled to KLH as the immunogen.</p>

<p>Staphylococcus aureus antibody was raised in rabbit using ATCC 27660 as the immunogen.</p>

<p>RELB antibody was raised in rabbit using the middle region of RELB as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>The APP antibody is a high-quality polyclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and detect amyloid precursor protein (APP), a key player in the formation of amyloid plaques associated with Alzheimer's disease.</p>

<p>The Nav1.6 antibody is a highly specific monoclonal antibody that targets the Nav1.6 antigen, a key protein involved in neuronal signaling. This antibody has been extensively studied for its role in regulating the activity of Nav1.6 channels, which are essential for proper nerve function.</p>

<p>GRM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit anti-sheep IgG (H+L) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>The IRS1 antibody is a monoclonal antibody that targets the insulin receptor substrate 1 (IRS1) protein. This protein plays a crucial role in mediating the effects of various growth factors and cytokines, such as interleukin-6. The IRS1 antibody specifically recognizes and binds to the IRS1 protein, inhibiting its signaling pathway and preventing downstream cellular responses.</p>

<p>HTR1E antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti Mouse IgG2a secondary antibody</p>

<p>MLDP antibody was raised in Guinea Pig using synthetic peptide C-terminal aa 451-463 of human MLDP as the immunogen.</p>

<p>Rabbit anti-bovine IgG (H+L) (HRP) was raised in rabbit using bovine IgG whole molecule as the immunogen.</p>

<p>ACVRL1 antibody was raised using the N terminal of ACVRL1 corresponding to a region with amino acids SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH</p>

<p>Rabbit anti-bovine IgG (Rhodamine) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>

<p>CCNB3 antibody was raised in rabbit using the N terminal of CCNB3 as the immunogen</p>

<p>MCP2 antibody was raised in rabbit using recombinant human MCP-2 as the immunogen.</p>

<p>Antithrombin III antibody was raised in sheep using human antithrombin purified from plasma as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rat thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.</p>

<p>Goat anti-human IgG (H+L) (Fab'2) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Carboxypeptidase N1 antibody was raised using the middle region of CPN1 corresponding to a region with amino acids EWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGD</p>

<p>The Salbutamol antibody is a highly specialized polyclonal antibody that targets the phosphatase growth factor-1 receptor. It is commonly used in life sciences research to study the effects of TGF-beta, collagen, and other growth factors. This antibody has been proven to have neutralizing properties, effectively blocking the activity of these growth factors and allowing researchers to better understand their role in various biological processes.</p>

<p>CLCC1 antibody was raised in rabbit using the N terminal of CLCC1 as the immunogen</p>

<p>The CDC25C antibody is a powerful tool used in Life Sciences research. It is an enzyme substrate that can be used for chromatographic analysis of reactive oxygen species (ROS) and binding proteins. This antibody specifically targets CDC25C, a protein kinase involved in cell cycle regulation. By targeting and inhibiting CDC25C, this antibody can effectively disrupt the cell cycle and inhibit cell division.</p>

<p>Rabbit polyclonal Histone H2A.X antibody</p>

<p>Goat anti Mouse IgG (H + L) secondary antibody</p>

<p>Olaquindox antibody is a polyclonal antibody that specifically targets the surface glycoprotein of Cryptosporidium parvum. This antibody forms an antigen-antibody complex, which can be detected using various immunoassays such as electrochemical impedance spectroscopy (EIS) or viability assays. Olaquindox antibody is widely used in the field of life sciences for research purposes and diagnostic applications related to Cryptosporidium infections. It is available both as a polyclonal and monoclonal antibody, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, Olaquindox antibody plays a crucial role in advancing our understanding of Cryptosporidium biology and developing effective strategies for disease control.</p>

<p>Rabbit anti-sheep IgG (H+L) (HRP) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Goat anti-chicken IgG (H+L) (Rhodamine) was raised in goat using chicken IgG, whole molecule as the immunogen.</p>

<p>GLYT1 antibody was raised in rabbit using a 20 amino acid peptide of rat GLYT1 as the immunogen.</p>

<p>Whole pig serum antibody (IgG fraction) was raised in rabbit using porcine serum as the immunogen.</p>

<p>Complement C3 antibody is a polyclonal antibody that specifically targets complement component C3. This antibody is widely used in life sciences research, particularly in the study of immune responses and inflammation. Complement C3 plays a crucial role in the complement system, which is an important part of the immune response against pathogens. The antibody can be used to detect and measure the levels of complement C3 in various samples, such as serum or tissue lysates. It can also be used for neutralizing experiments or to investigate the interaction between complement C3 and other molecules, such as chemokines or receptors. Additionally, this antibody has been utilized in studies involving aldehyde dehydrogenase 2 (ALDH2), ferritin, interferon, streptavidin, liver microsomes, collagen, refractive index measurements, and Fas-mediated apoptosis. With its high specificity and sensitivity, this Complement C3 antibody is an essential tool for researchers working in immunology and related fields.</p>

<p>Rabbit polyclonal STAT4 antibody</p>

<p>Rabbit polyclonal Dynamin 1 antibody</p>

<p>The Chk1 antibody is a highly specialized antibody that specifically targets activated proteins in human serum. It binds to agonist proteins and neutralizes their effects, preventing them from causing any harm. The Chk1 antibody also has the ability to bind to serum albumin protein, enhancing its stability and prolonging its effectiveness.</p>

<p>RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids  EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDV</p>

<p>PPAR gamma-2 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) G E T L G D S P I D P E S D S(16) C of human PPAR gamma-2.</p>

<p>Factor P antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>The JunB antibody is a highly specialized protein that functions as a monoclonal antibody. It specifically targets and neutralizes the activity of JunB, a transcription factor involved in various cellular processes. This antibody is capable of forming dimers with other antibodies, such as Polyclonal Antibodies, to enhance its neutralizing effect.</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>The GFP Antibody is a cytotoxic monoclonal antibody that targets the protein complex involved in various cellular processes. It specifically binds to the mineralocorticoid receptor, which plays a crucial role in regulating electrolyte balance and blood pressure. Additionally, this antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine, and dopamine, a neurotransmitter involved in mood regulation. The GFP Antibody also interacts with nuclear receptors and modulates their activity, thereby affecting gene expression. This product has high viscosity due to its glycosylation pattern and can be used in various applications within the Life Sciences field. Notably, it has been studied in conjunction with haloperidol, teriparatide, and ornithine for its potential therapeutic benefits.</p>

<p>Human cyclin E1 non-phosphopeptide (Thr395) region immunogen, Rabbit polyclonal Cyclin E1 antibody, cross reactive to mouse</p>

<p>The SMAD1 antibody is a polyclonal antibody that targets the SMAD1 protein. It plays a crucial role in various biological processes, including insulin signaling, cell proliferation, and differentiation. This antibody can be used in life sciences research to study the expression and function of SMAD1.</p>

<p>Sheep polyclonal Androstanedione antibody</p>

<p>The Androgen Receptor antibody is a neutralizing monoclonal antibody that targets the androgen receptor, a protein involved in the regulation of male sexual development and function. This antibody has been shown to inhibit the activity of the androgen receptor, leading to decreased growth factor signaling and reduced expression of genes regulated by androgens.</p>

<p>The mTOR antibody is a growth factor monoclonal antibody that targets the mammalian target of rapamycin (mTOR) protein kinase. It is designed to specifically bind to mTOR and inhibit its activity, which plays a crucial role in cell growth, proliferation, and survival. This antibody has been extensively tested for purity and is free from contaminants such as carbon quantum dots, colloidal particles, or other inorganic impurities.</p>

<p>PRLHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Plakophilin 1 antibody was raised in Guinea Pig using human recombinant plakophilin 1 as the immunogen.</p>

<p>TGF beta 1 antibody was raised in goat using CHO cell-derived recombinant human LAP (TGF-beta1) as the immunogen.</p>

<p>VEGFR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>GPR22 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti-cat IgG (H + L) was raised in goat using feline IgG whole molecule as the immunogen.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The p53 antibody is a polyclonal antibody that is used in Life Sciences research. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The antibody can be used in various applications, such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG, whole molecule as the immunogen.</p>

<p>The beta Catenin antibody is a protein that specifically targets and binds to β-catenin, a key protein involved in cell adhesion and signaling pathways. This monoclonal antibody is widely used in research and clinical applications to study the role of β-catenin in various biological processes.</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>

<p>Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The EGFR antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is used as a diagnostic reagent in the field of life sciences to detect and measure the levels of EGFR protein biomarkers. This antibody specifically recognizes and binds to EGFR, inhibiting its activation and downstream signaling pathways. By blocking the interaction between EGFR and its ligands, such as epidermal growth factor, the antibody effectively inhibits cell proliferation and survival. The EGFR antibody has been extensively studied for its potential therapeutic applications in cancer treatment, particularly in tumors that overexpress EGFR. Additionally, this antibody has shown promising results in preclinical studies as a potential nephrotoxic agent due to its ability to inhibit hydroxylase activity. Overall, the EGFR antibody is a valuable tool for researchers and clinicians in studying and targeting EGFR-related diseases.</p>

<p>Nesprin 2 Antibody</p>

<p>The HER2 antibody is a highly specialized antibody used in the field of Life Sciences. It can be either a polyclonal or monoclonal antibody, designed to target the HER2 protein molecule. This protein is found on the surface of certain cancer cells and is associated with aggressive tumor growth.</p>

<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>

<p>Donkey anti-goat IgG (H+L) (FITC) was raised in donkey using goat IgG, whole molecule as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Goat anti-mouse IgM (Fab'2) (FITC) was raised in goat using murine IgM mu chain as the immunogen.</p>

<p>The HNF4 alpha antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and neutralize the HNF4 alpha protein. This protein plays a crucial role in various biological processes, including the development and function of cardiomyocytes.</p>

<p>Human IgA antibody was raised in goat using human secretory IgA as the immunogen.</p>

<p>SLC5A3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti-human kappa chain (Fab'2) (FITC) was raised in goat using human kappa light chain as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.</p>

<p>Perilipin antibody was raised in guinea pig using duplicated N-terminus of perilipin as the immunogen.</p>

<p>GPR149 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CD49B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit anti-dog IgG (H+L) (Rhodamine) was raised in rabbit using canine IgG whole molecule as the immunogen.</p>

<p>ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE</p>

<p>The MARCKS antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is known to be involved in necrosis factor-related apoptosis-inducing pathways, as well as growth factor signaling. This antibody has been shown to interact with influenza hemagglutinin and regulate microvessel density.</p>

<p>The TAZ antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the transcriptional co-activator with PDZ-binding motif (TAZ), which plays a crucial role in pluripotent cells and various cellular processes. The TAZ antibody has been shown to inhibit the activity of TAZ, leading to decreased cell proliferation and increased apoptosis.</p>

<p>Hepatitis C Virus antibody was raised in goat using recombinant polypeptide containing core with NS3 and NS4 regions as the immunogen.Goats are US origin</p>

<p>The NAC1 antibody is a monoclonal antibody that targets interleukin-6 (IL-6), a growth factor involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting IL-6 signaling. It can also be used as an anti-HER2 antibody, targeting the HER2 receptor on cancer cells. The NAC1 antibody has been shown to inhibit endothelial growth and may have potential therapeutic applications in cancer treatment. Additionally, it has been found to modulate the viscosity of antibodies, enhancing their efficacy. This antibody holds great promise for targeted therapy and further research in the field of immunology.</p>

<p>GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal 4E-BP1 antibody</p>

<p>TG Antibody is a highly effective polyclonal antibody used in the field of Life Sciences. It has neutralizing properties and is specifically designed to target and bind to EGF-like (epidermal growth factor-like) molecules. This antibody can be used for various applications, including the detection and quantification of EGF-like proteins, as well as in research studies involving cell signaling pathways and growth factor interactions.</p>

<p>MLXIPL antibody was raised in rabbit using the N terminal of MLXIPL as the immunogen</p>

<p>CASP3 antibody was raised in rabbit using the N terminal of CASP3 as the immunogen</p>

<p>Alpha synuclein antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 116-131 of the c-terminus of human alpha-synuclein protein as the immunogen.</p>

<p>GPR75 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The HER2 antibody, also known as trastuzumab, is a highly effective cytotoxic agent used in the treatment of various cancers. This monoclonal antibody specifically targets the HER2 receptor, a glycoprotein that plays a crucial role in cell growth and division. By binding to the HER2 receptor, trastuzumab inhibits its activity and prevents the growth and proliferation of cancer cells.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>USP20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat RBC antibody was raised in rabbit using goat erythrocytes as the immunogen.</p>

<p>USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The SEK1 antibody is a monoclonal antibody that specifically targets lipoprotein lipase. It is commonly used in research and diagnostic applications to detect and quantify the levels of lipoprotein lipase in various biological samples. Lipoprotein lipase plays a crucial role in lipid metabolism, as it hydrolyzes triglycerides from circulating lipoproteins, allowing the release of free fatty acids for energy production or storage. This antibody can also be used to study other proteins involved in lipid metabolism, such as growth hormone receptor, collagen, tyrosine kinase receptor, and phosphatase. With its high specificity and sensitivity, the SEK1 antibody is an invaluable tool for researchers and clinicians working in the field of lipid biology and related disorders.</p>

<p>PF4 antibody was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.</p>

<p>LPAR5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids GKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMG</p>

<p>Keratin K12 antibody was raised in Guinea Pig using synthetic peptide of human keratin K12 coupled to KLH as the immunogen.</p>

<p>NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL</p>

<p>Sheep polyclonal Dehydromethyltestosterone 3 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Mettl4 antibody was raised in rabbit using the C terminal of Mettl4 as the immunogen</p>

<p>CDK5 antibody was raised in rabbit using the N terminal of CDK5 as the immunogen</p>

<p>Mouse anti Rat IgG2a secondary antibody</p>

<p>DNP antibody was raised in goat using Dinitrophenol (DNP) conjugate as the immunogen.</p>

<p>The MARCKS antibody is a highly specialized monoclonal antibody that targets specific proteins involved in cellular signaling pathways. This antibody has been extensively studied and shown to have various effects on different cell types. It has been found to modulate the activity of steroid hormones, chemokines, and growth factors, leading to changes in cell behavior.</p>

<p>The Caspase 8 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to caspase 8, an enzyme involved in apoptosis (cell death). This antibody can be used for various applications, including immunoassays, immunohistochemistry, and western blotting.</p>

<p>APP antibody was raised in goat using a peptide; GYENPTYKFFEQMQN, as the immunogen.</p>

<p>Goat anti-Rabbit IgG (H + L) was raised in goat using purified Rabbit IgG (H&amp;L) as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>GJA1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CBX6 antibody was raised in rabbit using the N terminal of CBX6 as the immunogen</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Mouse anti Rat IgM secondary antibody (HRP)</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>CBX3 antibody was raised in rabbit using the middle region of CBX3 as the immunogen</p>

<p>ZNF286 antibody was raised in rabbit using the C terminal of ZNF286 as the immunogen</p>

<p>Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.</p>

<p>Sheep polyclonal 17b Estradiol 6 antibody</p>

<p>The FGF Receptor 1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the FGF Receptor 1 protein. This antibody has been extensively studied and proven to have potent neutralizing activity against FGF Receptor 1, making it an ideal tool for research in the field of Life Sciences.</p>

<p>The LC3A antibody is a highly specific and reliable tool for immunoassays in the field of life sciences. It is an antibody that targets LC3A, a protein involved in autophagy and cellular homeostasis. This polyclonal antibody can be used in various applications such as western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Donkey anti Goat IgG (Heavy + Light chain) secondary antibody with AF594 photostable fluorescent dye label. Minimal cross-reaction with Human, Mouse, Chicken, Rabbit, Guniea Pig, Syrian Hamster, Horse, Rat. Lyophilized from 0.01M Na3PO4, 0.25M NaCl, pH 7.6, with 15mg/ml BSA, and 0.05% NaN3. Reconstitute with 0.4 ml of distilled Water.</p>

<p>USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The hnRNP A1 antibody is a highly activated antibody that possesses protease activity. It is widely used in the field of Life Sciences for various research purposes. This antibody specifically targets hnRNP A1, a glycoprotein involved in RNA processing and transport. The hnRNP A1 antibody can be used as an active agent in experiments to study the function and localization of hnRNP A1 within cells.</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>The ERAB antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It targets specific protein complexes involved in various cellular processes, including apoptosis and necrosis factor-related apoptosis-inducing pathways. This cytotoxic antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent in the field of Life Sciences.</p>

<p>TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.</p>

<p>NMDAR1 antibody is a highly specialized antibody used in life sciences research. It is commonly used to study the N-methyl-D-aspartate receptor (NMDAR), which plays a crucial role in neuronal function and synaptic plasticity. This antibody specifically targets the NMDAR1 subunit, allowing researchers to investigate its expression and localization in various tissues and cell types.</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from BALB/c mice as the immunogen.</p>

<p>Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>The TrkB antibody is a highly reactive and neutralizing polyclonal antibody that is used in the field of Life Sciences. It has the ability to bind to TGF-beta, a protein involved in various cellular processes. The TrkB antibody can be used as a diagnostic reagent for detecting the presence of alpha-fetoprotein, a biomarker for certain diseases. This antibody is produced using state-of-the-art techniques and undergoes rigorous quality control to ensure its effectiveness. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. The TrkB antibody is conjugated with streptavidin, which enables easy detection and visualization using techniques such as immunohistochemistry or western blotting. With its high affinity and specificity, this antibody is an invaluable tool for studying cellular signaling pathways and investigating disease mechanisms.</p>

<p>Mouse macrophage antibody was raised in rabbit using mouse macrophages as the immunogen.</p>

<p>The Synapsin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively tested and proven to have high affinity for the target receptor, making it an excellent tool for research purposes. This antibody specifically binds to activated receptors and exhibits neutralizing properties, effectively blocking their function. Additionally, it has been shown to interact with chemokines and phosphatases, further expanding its potential applications in various experimental settings. The Synapsin antibody is also capable of binding to alpha-fetoprotein and calmodulin, two important proteins involved in growth factor signaling pathways. Its versatility extends to adipose tissue studies as well, where it can be used to investigate cellular processes related to fat metabolism. With its reliable performance and compatibility with various detection methods such as immunofluorescence or Western blotting, this monoclonal antibody is an invaluable asset for researchers seeking to advance their understanding of complex biological systems.</p>

<p>Goat anti-mouse IgG (Fab'2) (Rhodamine) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.</p>

<p>Goat anti-human IgG (H+L) (Fab'2) (HRP) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>NT3 antibody was raised in goat using highly pure recombinant human NT-3 as the immunogen.</p>

<p>B3GALT6 antibody was raised using the C terminal of B3GALT6 corresponding to a region with amino acids VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE</p>

<p>HIV1 p24 antibody was raised in goat using purified native p24 from strain IIIB as the immunogen.</p>

<p>The FAK antibody is a highly effective neutralizing agent that targets dopamine. It is a monoclonal antibody produced by a hybridoma cell line. This antibody has been shown to specifically bind to interleukin-6 (IL-6), inhibiting its activity and preventing the activation of downstream signaling pathways. The FAK antibody also exhibits cytotoxic effects on cancer cells, making it a promising therapeutic option for the treatment of various malignancies. Additionally, this antibody can be used in research settings to study the role of IL-6 in different biological processes. With its high specificity and potency, the FAK antibody is a valuable tool for scientists and clinicians alike.</p>

<p>Purified Polyclonal CKMT2 antibody</p>

<p>TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR</p>

<p>Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.</p>

<p>SDF1 alpha antibody was raised in goat using highly pure recombinant murine SDF-1alpha as the immunogen.</p>

<p>Utx antibody was raised in rabbit using the N terminal of Utx as the immunogen</p>

<p>The mTOR antibody is a proteolytic enzyme that specifically targets the urokinase plasminogen activator (uPA). It is a monoclonal antibody that has been developed to inhibit the activity of uPA, which plays a crucial role in various physiological and pathological processes. The mTOR antibody has shown promising results in preclinical studies, demonstrating its ability to effectively block uPA-mediated collagen degradation, thrombocytopenia, and hyaluronic acid production. This antibody is widely used in Life Sciences research for studying the mechanisms of uPA-related diseases and developing potential therapeutic strategies. With its cytotoxic properties and high specificity for uPA, the mTOR antibody holds great potential as a targeted therapy for various conditions. It can be used in combination with other monoclonal antibodies or inhibitors to enhance its efficacy and broaden its application in different research fields. Whether you're working with human serum, adipose tissue, or other biological samples, the mTOR antibody provides reliable</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rabbit anti-bovine IgG (Rhodamine) was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.</p>

<p>SETD3 antibody was raised in rabbit using the middle region of SETD3 as the immunogen</p>