Primary Antibodies

<p>ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG</p>

<p>The EEA1 antibody is a biomolecule that plays a crucial role in the field of Life Sciences. It is an essential component in the study of interferon and interleukin-6, as it acts as an inhibitor for these molecules. The EEA1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody demonstrates neutralizing properties, making it highly effective in assays and experiments where protease activity needs to be inhibited. With its colloidal nature, the EEA1 antibody ensures accurate and reliable results. Researchers can rely on this antibody to enhance their understanding of complex biological processes and advance scientific knowledge in various fields.</p>

<p>The COL4A3 antibody is a polyclonal antibody that specifically targets the rubisco molecule. Rubisco is an enzyme involved in photosynthesis and is found in plants and some bacteria. This antibody has been developed for use in life sciences research and has the ability to neutralize the activity of rubisco. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The COL4A3 antibody is a valuable tool for researchers studying the role of rubisco in plant biology, as well as those investigating potential therapeutic targets for diseases related to rubisco dysfunction. Additionally, this antibody may have potential applications in the development of new drugs or treatments targeting rubisco-related disorders.</p>

<p>Rabbit polyclonal PBOV1 antibody</p>

<p>The MUC16 antibody is a monoclonal antibody that targets the MUC16 protein. This protein, also known as CA125, is a tumor marker that is often elevated in ovarian cancer. The MUC16 antibody specifically binds to the MUC16 protein, inhibiting its interaction with other molecules and preventing tumor growth and progression.</p>

<p>Affinity purified Rabbit polyclonal TULP1 antibody</p>

<p>EDN2 antibody was raised in Rabbit using Human EDN2 as the immunogen</p>

<p>Salmonella antibody (biotin) was raised in rabbit using a mixture of S. enteriditis, S. typhimurium and S. heidelburg as the immunogen.</p>

<p>Rabbit polyclonal ARTS1 antibody</p>

<p>Purified Polyclonal RAB30 antibody</p>

<p>CD31 antibody was raised in mouse using stimulated human Leukocytes as the immunogen.</p>

<p>ACVRL1 antibody was raised in Rabbit using Human ACVRL1 as the immunogen</p>

<p>Purified Rabbit polyclonal HER3 antibody (Tyr1197)</p>

<p>CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA</p>

<p>ACSM3 antibody was raised in Rabbit using Human ACSM3 as the immunogen</p>

<p>The STEAP1 antibody is a highly effective and activated agent that plays a crucial role in various biological processes. It specifically targets vitronectin, an extracellular matrix protein involved in cell adhesion and migration. The STEAP1 antibody has been extensively studied for its ability to neutralize the effects of autoantibodies, which can lead to autoimmune diseases.</p>

<p>Affinity purified Rabbit polyclonal Deltex1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HOXB9 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to HOXB9, a protein involved in various biological processes such as collagen synthesis and glycosylation. By inhibiting the activity of HOXB9, this antibody can be used to study its function and impact on cellular processes.</p>

<p>Rabbit polyclonal Beta Enolase antibody</p>

<p>Purified Rabbit polyclonal MPRIP antibody</p>

<p>C4d Complement fragment Monoclonal Antibody</p>

<p>LHRH Antibody is a monoclonal antibody that specifically targets luteinizing hormone-releasing hormone (LHRH). It has been shown to inhibit the activity of LHRH, which plays a crucial role in regulating reproductive functions. This antibody has interferon-like activity and can modulate the release of vasoactive intestinal peptide and colony-stimulating factors. Additionally, it has been demonstrated to enhance the production of interferon-gamma (IFN-gamma) in human serum. LHRH Antibody may also have potential therapeutic applications in the treatment of conditions such as prostate cancer and breast cancer, as it can interfere with the growth-promoting effects of LHRH on tumor cells.</p>

<p>DIRAS3 antibody was raised in Rabbit using Human DIRAS3 as the immunogen</p>

<p>Rabbit polyclonal Ceruloplasmin antibody (FITC)</p>

<p>CMV antibody (FITC) was raised in goat using purified virions of strain AD169 as the immunogen.</p>

<p>DNAI1 antibody was raised in Rabbit using Human DNAI1 as the immunogen</p>

<p>The NOS3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the NOS3 protein, also known as endothelial nitric oxide synthase. This antibody is widely used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>FAM121B antibody was raised using the N terminal Of Fam121B corresponding to a region with amino acids PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL</p>

<p>Purified Polyclonal LYAR antibody</p>

<p>The cRel antibody is a highly specialized monoclonal antibody that targets the cRel protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The cRel antibody specifically binds to the glutamate residues of the cRel protein, which plays a crucial role in regulating gene expression and immune response.</p>

<p>CDK2AP1 antibody was raised in Rabbit using Human CDK2AP1 as the immunogen</p>

<p>Purified Polyclonal LRAT antibody</p>

<p>KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF</p>

<p>PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR</p>

<p>Rabbit Polyclonal IGF1R antibody (Tyr1161)</p>

<p>Rabbit polyclonal GRM5 antibody</p>

<p>Rabbit polyclonal CHRM4 antibody</p>

<p>EPS15L1 antibody was raised in Rabbit using Human EPS15L1 as the immunogen</p>

<p>Purified Polyclonal NDUFA4L2 antibody</p>

<p>RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN</p>

<p>SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ</p>

<p>The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.</p>

<p>The IGF1R antibody is a growth factor that belongs to the class of monoclonal antibodies. It is similar to trastuzumab and other antibodies in its ability to target specific proteins and inhibit their activity. The IGF1R antibody specifically targets the insulin-like growth factor 1 receptor (IGF1R), which plays a crucial role in cell proliferation, differentiation, and survival. By binding to IGF1R, this antibody prevents the activation of downstream signaling pathways, thereby inhibiting tumor growth.</p>

<p>COX4I1 antibody was raised using the N terminal of COX4I1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK</p>

<p>AES antibody was raised using the C terminal of AES corresponding to a region with amino acids GLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD</p>

<p>CNOT7 antibody was raised in Rabbit using Human CNOT7 as the immunogen</p>

<p>The NF kappaB p65 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It is designed to specifically bind to the NF kappaB p65 protein, which plays a critical role in regulating gene expression and cellular processes. This antibody has been extensively tested and validated for its receptor binding activity in human serum.</p>

<p>Rabbit polyclonal SCAND1 antibody</p>

<p>Purified Polyclonal MED15 antibody</p>

<p>Rabbit polyclonal TAS2R8 antibody</p>

<p>Rabbit Polyclonal FLT3 antibody (Tyr591)</p>

<p>Purified Polyclonal DUSP16 antibody</p>

<p>The p90RSK antibody is a cytotoxic monoclonal antibody that targets the p90 ribosomal S6 kinase (p90RSK). It is commonly used in research to study growth factors, such as hepatocyte growth factor. This antibody has been shown to inhibit the activity of p90RSK, which is involved in multiple cellular processes including cell proliferation and survival. The p90RSK antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. It has also been shown to bind to other proteins such as collagen, creatine kinase, fibronectin, and retinoid receptors. This antibody may have potential therapeutic applications due to its ability to target specific proteins involved in disease pathways.</p>

<p>Purified Polyclonal GPR82 antibody</p>

<p>Affinity purified Rabbit polyclonal MUS81 antibody</p>

<p>CD8 antibody (PE) was raised in mouse using feline CD8 as the immunogen.</p>

<p>ALDH8A1 antibody was raised in Rabbit using Human ALDH8A1 as the immunogen</p>

<p>The CIAPIN1 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the CIAPIN1 protein. This protein has been shown to play a crucial role in various cellular processes, including cell growth, apoptosis, and immune response.</p>

<p>Rabbit polyclonal DAD1 antibody (biotin)</p>

<p>HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS</p>

<p>Rabbit polyclonal RPL8 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal RBPJ kappa antibody</p>

The CtBP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets CtBP2, a protein involved in various cellular processes such as epidermal growth factor signaling and regulation of β-catenin. This antibody is designed to recognize and bind to CtBP2 with high affinity, making it an essential tool for studying the function and localization of this protein.

<p>Affinity purified Rabbit polyclonal MCH1R antibody</p>

<p>ERBB4 antibody was raised in Rabbit using Human ERBB4 as the immunogen</p>

<p>Rabbit polyclonal iNOS antibody (Tyr151)</p>

<p>Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.</p>

<p>EPB41 antibody was raised in Rabbit using Human EPB41 as the immunogen</p>

<p>The TFEB antibody is a versatile and powerful tool in the field of Life Sciences. It is an antiviral and natriuretic antibody that specifically targets brain natriuretic peptide (BNP). This antibody can be used for various applications, including electrophoresis, where it can detect BNP in human serum samples. Additionally, the TFEB antibody has been shown to have chemokine activity, making it an excellent choice for studying immune responses.</p>

<p>Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids  PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW</p>

<p>Rabbit polyclonal RAD23A antibody (HRP)</p>

<p>ABAT antibody was raised in Rabbit using Human ABAT as the immunogen</p>

<p>Rabbit polyclonal NADAP antibody</p>

<p>FUT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL</p>

<p>MCSF antibody was raised in Rabbit using Human MCSF as the immunogen</p>

<p>KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ</p>

<p>AKR7A3 antibody was raised in Rabbit using Human AKR7A3 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal ITPK1 antibody</p>

<p>DAP3 antibody was raised in rabbit using the C terminal of DAP3 as the immunogen</p>

<p>The CEA antibody is a monoclonal antibody used in Life Sciences. It has pro-angiogenic activity, meaning it promotes the growth of new blood vessels. This antibody can be used in various research applications, such as immunoassays and immunohistochemistry, to detect and quantify CEA (carcinoembryonic antigen) levels. CEA is a protein that is often elevated in certain types of cancer, particularly colorectal cancer. By targeting CEA, this antibody can help researchers better understand the role of CEA in cancer development and progression. Additionally, the CEA antibody has been shown to interact with other proteins, such as annexin A2 and epidermal growth factor, suggesting potential involvement in signaling pathways related to cell growth and proliferation. With its high specificity and sensitivity, the CEA antibody is a valuable tool for studying CEA-related processes and developing diagnostic tests for cancer detection.</p>

<p>Rabbit polyclonal p53 antibody (Ser15)</p>

<p>Rabbit polyclonal BMP6 antibody (FITC)</p>

<p>Rabbit polyclonal NFKP p65 antibody (Thr435)</p>

<p>RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ</p>

<p>ASS1 antibody was raised in Rabbit using Human ASS1 as the immunogen</p>

<p>Rabbit polyclonal NR1I2 antibody</p>

<p>The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.</p>

<p>The TIE1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target the TIE1 protein, which is activated by Helicobacter pylori infection. The antibody can be immobilized on an electrode or colloidal surface for various applications such as enzyme-linked immunosorbent assays (ELISA) or Western blotting. Additionally, the TIE1 antibody has been shown to have high affinity for collagen and can be used for studying collagen-related diseases. This antibody is reactive with human serum and can be used to detect and quantify TIE1 protein levels in biological samples. Its specificity and sensitivity make it an essential tool in understanding the role of TIE1 in various biological processes, including erythropoietin signaling and growth factor regulation.</p>

<p>ARHGDIB antibody was raised in Rabbit using Human ARHGDIB as the immunogen</p>

<p>The PGC antibody is an anti-Mertk antibody that belongs to the class of antibodies. It is cytotoxic and has been shown to regulate E-cadherin expression. This antibody specifically targets nuclear markers and can be used in various life sciences applications. The PGC antibody also interacts with growth factors and plays a role in interferon signaling pathways. Additionally, it has been found to have multidrug resistance properties and can inhibit the activity of the circumsporozoite protein. With its ability to target tyrosine residues, the PGC antibody is a valuable tool for researchers working with monoclonal antibodies.</p>

<p>Rabbit polyclonal DGKK antibody</p>

<p>ApoBEC3G antibody was raised using the N terminal of APOBEC3G corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC</p>

<p>Streptavidin antibody (FITC) was raised in rabbit using streptavidin as the immunogen.</p>

<p>The TAP1 Antibody is a high-quality monoclonal antibody that is specifically designed for use in Life Sciences research. This antibody targets the TAP1 protein, which plays a crucial role in antigen presentation and recombination processes within cells. By binding to the TAP1 protein, this antibody allows researchers to study its function and investigate its involvement in various cellular processes.</p>

<p>Rabbit polyclonal H2BF antibody (HRP)</p>

<p>Rabbit polyclonal NUP50 antibody</p>

<p>DNAJC5B antibody was raised in Rabbit using Human DNAJC5B as the immunogen</p>

<p>C4d Complement fragment Monoclonal Antibody</p>

<p>Rabbit polyclonal GRK2 antibody (Ser685)</p>

<p>Rabbit polyclonal ZNF147 antibody</p>

<p>Purified Polyclonal ABCF2 antibody</p>

<p>Affinity purified Rabbit polyclonal GSTM1 antibody</p>

<p>CPA3 antibody was raised in Rabbit using Human CPA3 as the immunogen</p>

<p>CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.</p>

<p>Rabbit Polyclonal PLCG1 antibody (Tyr771)</p>

<p>Affinity purified Rabbit polyclonal SLC25A33 antibody</p>

<p>Rabbit polyclonal DJ1 antibody</p>

<p>MYO9B antibody was raised in Rabbit using Human MYO9B as the immunogen</p>

<p>VWF antibody (biotin) was raised in goat using human vWF purified from plasma as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal XRCC3 antibody</p>

<p>Purified Rabbit polyclonal OR2G6 antibody</p>

<p>Rabbit polyclonal ACOT2 antibody</p>

<p>C11ORF54 antibody was raised using the N terminal Of C11Orf54 corresponding to a region with amino acids CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI</p>

<p>ADH6 antibody was raised in Rabbit using Human ADH6 as the immunogen</p>

<p>IL4 antibody was raised in rabbit using highly pure recombinant murine IL-4 as the immunogen.</p>

<p>Purified Polyclonal TLK1 antibody</p>

<p>Affinity purified Rabbit polyclonal HPS3 antibody</p>

<p>Purified Polyclonal RGS5 antibody</p>

<p>Affinity purified Rabbit polyclonal TCP1 beta antibody</p>

<p>Purified Rabbit polyclonal TSC2 antibody (Tyr1571)</p>

<p>CCR4 antibody was raised in rabbit using the middle region of CCR4 as the immunogen</p>

<p>CREB3L2 antibody was raised in Rabbit using Human CREB3L2 as the immunogen</p>

<p>The EDG6 antibody is a highly specialized antibody that targets the dopamine receptor, fibronectin, and tyrosine kinase receptors. It is designed to specifically bind to these receptors when they are activated, allowing for precise modulation of cellular signaling pathways. This antibody has been shown to inhibit the activity of sulphates and collagen, which are involved in various cellular processes such as cell adhesion and migration. Additionally, the EDG6 antibody has been found to act as an inhibitory factor against certain enzymes such as phosphatase and calpain. With its unique properties, this antibody holds great potential in the development of novel therapeutic strategies targeting growth factors and other disease-related molecules.</p>

<p>RPL14 antibody was raised in rabbit using the C terminal of RPL14 as the immunogen</p>

<p>Purified Polyclonal anti-human TFPI Biotinylated Antibody</p>

<p>Affinity purified Rabbit polyclonal PIK3R1 antibody</p>

<p>PTPRB Monoclonal Antibody</p>

<p>CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen</p>

<p>CLK2 antibody was raised in Rabbit using Human CLK2 as the immunogen</p>

<p>DYRK1A antibody was raised using a synthetic peptide corresponding to a region with amino acids INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM</p>

<p>The PUMA antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the PUMA protein, which plays a crucial role in regulating cell death. This antibody is commonly used in studies involving apoptosis, cancer research, and drug development.</p>

<p>AMY2B antibody was raised in Rabbit using Human AMY2B as the immunogen</p>

<p>Affinity purified Mouse polyclonal DAPK2 antibody</p>

<p>Rabbit polyclonal GPR176 antibody</p>

<p>Affinity purified Rabbit polyclonal SCIN antibody</p>

<p>ASCC2 antibody was raised in Rabbit using Human ASCC2 as the immunogen</p>

<p>DNAJB3 antibody was raised in Rabbit using Human DNAJB3 as the immunogen</p>

<p>RSV antibody (biotin) was raised in goat using human RSV isolate as the immunogen.</p>

<p>DDO antibody was raised in rabbit using the C terminal of DDO as the immunogen</p>

<p>The NR4A1 antibody is a monoclonal antibody that exhibits cytotoxic properties and acts similar to insulin-like growth factor. It is an anti-HER2 antibody that specifically targets HER2-positive cancer cells. The NR4A1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to have a positive impact on thrombocytopenia by increasing platelet count. This protein is also involved in binding proteins such as trastuzumab and epidermal growth factor, making it a valuable tool for research in the field of nuclear growth factors.</p>

<p>Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.</p>

<p>COX6B1 antibody was raised in Rabbit using Human COX6B1 as the immunogen</p>

<p>DPP3 antibody was raised in Rabbit using Human DPP3 as the immunogen</p>

<p>XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC</p>

<p>Affinity purified Rabbit polyclonal Plexin D1 antibody</p>

<p>The DP1 antibody is a cytotoxic polyclonal antibody that targets mesothelin, a protein involved in cell growth and differentiation. It is commonly used in Life Sciences research to study the effects of mesothelin on various cellular processes. The DP1 antibody has been shown to inhibit the activity of mesothelin by binding to its receptor site, thereby preventing the binding of growth factors such as erythropoietin and epidermal growth factor. This inhibition leads to a decrease in cell proliferation and an increase in apoptosis. The DP1 antibody is highly specific for mesothelin and does not cross-react with other proteins or receptors. It is available as both a polyclonal and monoclonal antibody, allowing researchers to choose the most appropriate option for their specific experimental needs.</p>

<p>ADAM12 antibody was raised in Rabbit using Human ADAM12 as the immunogen</p>

<p>Rabbit polyclonal AATF antibody (biotin)</p>

<p>AFAP1 antibody was raised in Rabbit using Human AFAP1 as the immunogen</p>

<p>CLU antibody was raised in Rabbit using Human CLU as the immunogen</p>

<p>The Influenza B Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody is designed to specifically target and bind to the Influenza B virus, preventing its replication and spread within the body. It has been extensively tested and validated for its high specificity and sensitivity in detecting and neutralizing the Influenza B virus.</p>

<p>GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP</p>

<p>Affinity purified Rabbit polyclonal COMMD7 antibody</p>

<p>Affinity purified Rabbit polyclonal MRPS5 antibody</p>

<p>Affinity purified Rabbit polyclonal GRAP antibody</p>

<p>The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). It can be used for various applications, including research and diagnostic purposes. The EGFR antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.</p>

<p>Rabbit polyclonal ETBR2 antibody</p>

<p>RUVBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGV</p>

<p>The FAK antibody is a highly specialized monoclonal antibody that targets focal adhesion kinase (FAK). FAK is a protein involved in cell adhesion and migration, as well as signal transduction pathways. This antibody specifically binds to FAK and can be used for various applications in life sciences research.</p>

<p>Rabbit Polyclonal STAT3 antibody (Tyr705)</p>

<p>Rabbit polyclonal ANKK1 antibody</p>

<p>NUDT16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE</p>

<p>EPO antibody was raised in mouse using recombinant human EPO as the immunogen.</p>

<p>COX6C antibody was raised in Rabbit using Human COX6C as the immunogen</p>

<p>Rabbit polyclonal PSMD13 antibody</p>

<p>Rabbit polyclonal MAPK1/2 antibody (Thr202/Tyr204)</p>

<p>Rabbit polyclonal HSF1 antibody (Ser303)</p>

<p>CD320 antibody was raised in Rabbit using Human CD320 as the immunogen</p>

<p>FXYD5 antibody was raised in Rabbit using Human FXYD5 as the immunogen</p>

<p>WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA</p>

<p>RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK</p>

<p>IL10 antibody (biotin) was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.</p>

<p>CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.</p>

<p>TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT</p>

<p>The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.</p>

<p>Purified Polyclonal EPS8L3 antibody</p>

<p>AKR1C1 antibody was raised in rabbit using the N terminal of AKR1C1 as the immunogen</p>

<p>Goat anti Pig IgM secondary antibody (Alk Phos)</p>

<p>Rabbit polyclonal Myelodysplasia Syndrome 1 antibody</p>

<p>UBE2O antibody was raised using the middle region of UBE2O corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR</p>

<p>Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK</p>

<p>The CD318 antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and is commonly used for antibody-drug conjugates. This antibody specifically targets the CD20 protein, which is found on the surface of certain cells. CD318 antibodies have been extensively researched and are known for their ability to inhibit the growth and proliferation of these cells.</p>

<p>ADH1A antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA</p>

<p>DRG2 antibody was raised in Rabbit using Human DRG2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal cGK1 alpha antibody</p>