Primary Antibodies

<p>Keratin K73 antibody was raised in Guinea Pig using synthetic peptide of human keratin K73 coupled to KLH as the immunogen.</p>

<p>HSPB1 antibody was raised in rabbit using the C terminal of HSPB1 as the immunogen</p>

<p>KLHL1 antibody was raised in rabbit using the middle region of KLHL1 as the immunogen</p>

<p>The Caveolin 1 antibody is a polyclonal antibody that specifically targets the Caveolin 1 protein. This protein is found in the cell membrane and plays a crucial role in various cellular processes. The Caveolin 1 antibody can be used in research and diagnostic applications to study the function and localization of this protein.</p>

<p>SPZ1 antibody was raised in rabbit using the C terminal of SPZ1 as the immunogen</p>

<p>GABRA2 antibody was raised in rabbit using the middle region of GABRA2 as the immunogen</p>

<p>Goat anti-human kappa chain (Fab'2) was raised in goat using human kappa light chain as the immunogen.</p>

<p>SLC33A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG</p>

<p>Rabbit polyclonal HDAC4/HDAC5/HDAC9 antibody</p>

<p>Mouse monoclonal Benzoylecgonine/Cocaine antibody</p>

<p>CANX antibody was raised in rabbit using the C terminal of CANX as the immunogen</p>

<p>MESP2 antibody was raised in rabbit using the C terminal of MESP2 as the immunogen</p>

<p>HSP90AB1 antibody was raised in rabbit using the N terminal of HSP90AB1 as the immunogen</p>

<p>The Tyrosine Hydroxylase antibody is a highly specific and potent monoclonal antibody that targets the tyrosine hydroxylase enzyme. This enzyme is involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The antibody has been extensively tested and validated for its ability to neutralize the activity of tyrosine hydroxylase, making it an invaluable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.</p>

<p>SLC12A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL</p>

<p>CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA</p>

<p>CK1 delta antibody was raised in goat using residues 310-327 of human casein kinase 1d located at the C-terminus as the immunogen.</p>

<p>MAPK14 antibody was raised in rabbit using the C terminal of MAPK14 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Peptide YY antibody was raised in guinea pig using synthetic porcine peptide TT as the immunogen.</p>

<p>RNF34 antibody was raised in rabbit using the middle region of RNF34 as the immunogen</p>

<p>The Caspase 3 antibody is a highly effective and cytotoxic medicament used in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, is specifically designed to target and neutralize activated caspase 3 proteins. By binding to these proteins, the Caspase 3 antibody effectively inhibits their activity, preventing cell death and promoting cell survival.</p>

<p>SCG3 antibody was raised in rabbit using the C terminal of SCG3 as the immunogen</p>

<p>NPBWR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH</p>

<p>Rabbit polyclonal Stathmin 1 antibody</p>

<p>The Aurora A antibody is a polyclonal antibody commonly used in life sciences research. It specifically targets the Aurora A protein, which plays a crucial role in cell division and is highly expressed in human hepatocytes. By binding to Aurora A, this antibody can modulate its activity and inhibit cell proliferation.</p>

<p>OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Bcat1 antibody was raised in rabbit using the C terminal of Bcat1 as the immunogen</p>

<p>The Tau antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets and binds to the protein Tau, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. The antibody has been extensively studied and validated for its specificity and sensitivity.</p>

<p>CDK4 antibody was raised in rabbit using the C terminal of CDK4 as the immunogen</p>

<p>IL1RL2 antibody was raised in rabbit using the N terminal of IL1RL2 as the immunogen</p>

<p>Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>Testosterone 19 antibody was raised in rabbit using testosterone-19-HSA as the immunogen.</p>

<p>Mad1 Antibody</p>

<p>Spi2A Monoclonal Antibody</p>

<p>Goat anti-mouse IgM (Fab'2) was raised in goat using murine IgM mu chain as the immunogen.</p>

<p>Proteasome 19S S7 antibody was raised in rabbit using human recombinant proteasome 19S subunit S7 as the immunogen.</p>

<p>Goat anti-Guinea Pig IgG (H + L) (HRP) was raised in goat using purified Guinea Pig IgG (H&amp;L) as the immunogen.</p>

<p>Rabbit anti-mouse kappa chain (biotin) was raised in rabbit using murine kappa chain as the immunogen.</p>

<p>Sheep polyclonal 4 Nitrophenyl SEM antibody</p>

<p>The EGFR antibody is a growth factor monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It contains carbonyl groups, histidine, and acid residues that enable it to bind to the EGFR protein. This antibody has been extensively studied and proven to have neutralizing effects on EGFR signaling pathways, making it an effective therapeutic option in the field of Life Sciences.</p>

<p>TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen</p>

<p>The eIF2 alpha antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the protein eIF2 alpha, which plays a crucial role in cellular processes such as translation initiation. By blocking the activity of eIF2 alpha, this antibody can be used to study its function and regulation in various biological systems.</p>

<p>MBNL2 antibody was raised in rabbit using the middle region of MBNL2 as the immunogen</p>

<p>Treponema pallidum antibody was raised in rabbit using highly purified Treponema pallidum as the immunogen.</p>

<p>CPXCR1 antibody was raised in rabbit using the N terminal of CPXCR1 as the immunogen</p>

<p>POLR2B antibody was raised in rabbit using the N terminal of POLR2B as the immunogen</p>

<p>Rat anti Mouse IgG3 is a secondary antibody that is used in various research applications. It specifically targets mouse IgG3 antibodies and can be used for detection, quantification, and purification purposes. This antibody has been extensively tested and validated for its specificity and sensitivity. It is commonly used in immunology, life sciences, and biomedical research. Rat anti Mouse IgG3 has shown excellent performance in assays such as ELISA, western blotting, immunohistochemistry, flow cytometry, and more. With its high affinity and low cross-reactivity, this antibody ensures accurate and reliable results in your experiments. Trust Rat anti Mouse IgG3 to enhance the efficiency and accuracy of your research in the field of Life Sciences.</p>

<p>ERK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII</p>

<p>Purified Polyclonal MKK2 antibody</p>

<p>goat anti-rat IgM was raised in goat using rat IgM mu chain as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal TLE3 antibody (N-terminal)</p>

<p>Goat anti-bovine IgG (FITC) was raised in goat using bovine IgG F(c) fragment as the immunogen.</p>

<p>The beta Amyloid antibody is a highly effective and versatile product that offers a range of benefits in the field of Life Sciences. It is a Polyclonal Antibody that has been specifically designed to target and neutralize the beta-amyloid protein, which is associated with neurodegenerative diseases such as Alzheimer's.</p>

<p>The HDAC4 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody specifically designed to target and bind to glial fibrillary acidic protein (GFAP), an important marker for astrocytes in the central nervous system. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blot analysis.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>The HSF1 antibody is a highly specialized antibody that targets the heat shock factor 1 (HSF1) protein. This protein plays a crucial role in cellular stress response and regulation of gene expression. The HSF1 antibody is designed to specifically bind to HSF1, neutralizing its activity and preventing it from activating stress response genes.</p>

<p>Mkx antibody was raised in rabbit using the C terminal of Mkx as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rabbit polyclonal Stathmin 1 antibody</p>

<p>Rabbit anti-bovine IgG (HRP) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research to study catecholaminergic neurons. This antibody specifically targets and detects tyrosine hydroxylase, the key enzyme involved in dopamine synthesis. By binding to tyrosine hydroxylase, this antibody allows researchers to visualize and study the distribution and activity of dopaminergic neurons in various tissues and cell cultures.</p>

<p>SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF</p>

<p>Rabbit anti-human IgG was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.</p>

<p>Guf1 antibody was raised in rabbit using the C terminal of Guf1 as the immunogen</p>

<p>The Chloramphenicol antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to chloramphenicol, a medicament commonly used as an anticoagulant in medical treatments. This antibody is capable of recognizing and binding to the molecule drug with high affinity and specificity.</p>

<p>Diclazuril antibody is a polyclonal antibody that has cell proliferation inhibitory properties. It is used as a medicament in the field of Life Sciences. This antibody is produced using recombinant vaccinia and can be used for various applications, including antiviral research. Diclazuril antibody has been shown to inhibit syncytia formation, which is the fusion of multiple cells into a single large cell. It also has neutralizing effects against EGFR protein, which plays a crucial role in cell growth and division. Additionally, this antibody can be used in combination with other active agents, such as monoclonal antibodies or chemokines, to enhance its therapeutic effects.</p>

<p>Purified Polyclonal Cotinine-3 Antibody</p>

<p>Rabbit anti-rat IgG (H+L) (biotin) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>Goat anti-rabbit IgG (H+L) (Rhodamine) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Complement C9 antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Goat anti-human IgG/IgA/IgM (H+L) (FITC) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen</p>

<p>The Myc antibody is a protein that specifically targets and binds to the Myc protein, a transcription factor that plays a critical role in cell growth and proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of the Myc protein. It can be used for various applications, including Western blotting, immunoprecipitation, immunohistochemistry, and flow cytometry.</p>

<p>The Gentamycin antibody is a monoclonal antibody that has been developed to target and neutralize the effects of Gentamycin, a commonly used antibiotic. This antibody specifically binds to Gentamycin, preventing it from interacting with its target receptors and inhibiting its antibacterial activity.</p>

<p>Rabbit polyclonal FOXP4 antibody</p>

<p>MYB antibody was raised in rabbit using the N terminal of MYB as the immunogen</p>

<p>Goat anti Mouse IgG1 secondary antibody with AF488 photostable fluorescent dye. Minimal cross reactivity with human, bovine and rabbit serum proteins. Does not react with other mouse IgG subtypes, IgM or the Fab portion of mouse IgG1. Supplied as a lyophilized powder in 0.01M sodium phosphate, 0.25 M NaCl, pH 7.6, and 0.05% sodium azide, with 15 mg/ml BSA.</p>

<p>HSF1 antibody was raised in rabbit using the C terminal of HSF1 as the immunogen</p>

<p>The ATR antibody is a polyclonal antibody that is highly effective in targeting specific antigens. It has been extensively used in various assays in the field of Life Sciences. This antibody exhibits cytotoxic properties and has shown promising results in inhibiting the activity of fibrinogen, glp-1, myostatin, elastase protein, circumsporozoite protein, alpha-synuclein, and natriuretic peptides. Whether you are conducting research or developing diagnostic tools, the ATR antibody is an invaluable tool that can provide accurate and reliable results. With its high specificity and sensitivity, this monoclonal antibody is a must-have for any researcher or scientist working in the field of Life Sciences.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Polyclonal Cotinine 3 Antibody</p>

<p>Sheep polyclonal Norbuprenorphine antibody</p>

<p>Oxycodone antibody was raised in mouse using oxycodone-BSA as the immunogen.</p>

<p>USP20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A830039H10RIK antibody was raised in rabbit using the C terminal of A830039H10RIK as the immunogen</p>

<p>The eIF4B antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to eIF4B, an important protein involved in the regulation of gene expression. This antibody can be used in various research applications, including the study of t-cell antigens, actin dynamics, and mesenchymal stem cell biology.</p>

<p>Goat anti-rabbit IgG was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>Vimentin antibody was raised in guinea pig using vimentin purified from calf lens as the immunogen.</p>

<p>PKR antibody is a specific antibody used in Life Sciences for various applications. It can be utilized as a vaccine adjuvant composition, enhancing the immune response to vaccines. This monoclonal antibody has been extensively studied and proven effective in phenotypic assays, such as intravascular hemolysis. Additionally, it has shown promising results in the development of recombinant vaccinia-based anticancer agents.</p>

<p>ZNF529 antibody was raised in rabbit using the middle region of ZNF529 as the immunogen</p>

<p>PDCD4 antibody was raised in rabbit using the N terminal of PDCD4 as the immunogen</p>

<p>Donkey anti Sheep IgG (H + L) secondary antibody (rhodamine)</p>

<p>SIRT4 antibody was raised in rabbit using the N terminal of SIRT4 as the immunogen</p>

<p>Rabbit anti-cat IgG (Rhodamine) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>gp210 Antibody (C-terminal)</p>

<p>VIPR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MAGEA9 antibody was raised in rabbit using the N terminal of MAGEA9 as the immunogen</p>

<p>The Methamphetamine antibody is a reactive antibody that is used in Life Sciences for various applications. It specifically targets methamphetamine, a potent stimulant drug. This antibody can be used in research and diagnostic settings to detect the presence of methamphetamine in human serum samples. It has high affinity and specificity for methamphetamine, making it an ideal tool for detecting and quantifying this drug. The Methamphetamine antibody is also capable of neutralizing the effects of methamphetamine by binding to it and preventing its interaction with cellular targets. This antibody can be conjugated with streptavidin or other molecules to facilitate detection or purification processes. Overall, the Methamphetamine antibody is a valuable tool for studying the effects of methamphetamine and developing peptide agents or therapeutic strategies to counteract its harmful effects.</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.</p>

<p>Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H &amp; L) as the immunogen.</p>

<p>Goat anti-human IgG was raised in goat using human IgG heavy chain as the immunogen.</p>

<p>Goat anti-human IgG (Fab'2) (FITC) was raised in goat using human IgG F(ab')2 fragment as the immunogen.</p>

<p>EMR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK</p>

<p>PTPN5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE</p>

<p>The c-kit antibody is a highly specialized antibody that targets the c-kit protein. It has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. The c-kit antibody is commonly used in experiments involving imatinib, an important drug used to treat certain types of cancer.</p>

<p>CD29 antibody is a polyclonal antibody that specifically targets the CD29 protein. This protein, also known as integrin beta-1, plays a crucial role in cell adhesion and migration. The CD29 antibody can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>Sheep polyclonal Amino Benzimidazole Sulphone antibody</p>

<p>NR5A2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Transferrin antibody was raised in rabbit using human transferrin as the immunogen.</p>

<p>Goat anti Rabbit IgG (H + L) secondary antibody (FITC)</p>

<p>Goat anti-human kappa chain (HRP) was raised in goat using human kappa chain as the immunogen.</p>

<p>Sheep polyclonal Estriol 6 antibody</p>

<p>This antibody reacts with heavy (mu) chains on human IgM.</p>

<p>Goat anti-rabbit IgG (H+L) (HRP) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>SDF1a antibody was raised in rabbit using E. Coli-expressed amino acids 20-89 of murine SDF-1 alpha as the immunogen.</p>

<p>The Caspase 9 antibody is a highly effective monoclonal antibody that targets caspase-9, an enzyme involved in programmed cell death. This antibody is commonly used in life sciences research and diagnostic applications. It specifically recognizes the caspase-9 antigen and can be immobilized for various experimental purposes.</p>

<p>The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.</p>

<p>The Synaptotagmin antibody is a highly specialized globulin that is used in various research and medical applications. This antibody specifically targets and neutralizes synaptotagmin, a protein involved in neurotransmitter release at the synapse. It has been extensively studied and characterized for its ability to inhibit lipoprotein lipase activity, making it an important tool in lipid metabolism research.</p>

<p>GRHL2 antibody was raised in rabbit using the middle region of GRHL2 as the immunogen</p>

<p>Goat anti-rat IgG/IgA/IgM (H+L) (Alk Phos) was raised in goat using rat IgG, IgA and IgM whole molecule as the immunogen.</p>

<p>alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.</p>

<p>The STAT3 antibody is a highly effective monoclonal antibody that is used for various applications. It has low density and is specifically designed to target and neutralize the activated form of STAT3 protein. This antibody has been extensively studied and shown to have antiangiogenic activity, making it a valuable tool in cancer research and therapy. Additionally, the STAT3 antibody has been found to inhibit glycation, reduce the production of reactive oxygen species, and block the action of interleukin-6, a pro-inflammatory cytokine. With its ability to interfere with endocytic uptake and fatty acid metabolism, this antibody is an essential agent in studying growth factors and their signaling pathways. Whether you are conducting research or developing therapeutic interventions, the STAT3 antibody is a reliable tool that will help you achieve your goals.</p>

<p>CD51 antibody was raised in rabbit using a synthetic protein corresponding to residues 1022-1034 of the human alpha V integrin subunit as the immunogen.</p>

<p>Goat anti Mouse IgG1 secondary antibody (FITC)</p>

<p>FLJ31875 antibody was raised in rabbit using the middle region of FLJ31875 as the immunogen</p>

<p>Rabbit anti-goat IgG (H + L) (HRP) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>Rrabbit anti-mouse lambda chain (Rhodamine) was raised in rabbit using murine lambda light chain as the immunogen.</p>

<p>UBXD2 antibody was raised in rabbit using the middle region of UBXD2 as the immunogen</p>

<p>MMP13 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET</p>

<p>RARB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit anti-human IgM was raised in rabbit using human IgM (Fc5m) fragment as the immunogen.</p>

<p>Factor IX antibody was raised in goat using human Factor IX as the immunogen.</p>

<p>Rabbit polyclonal Cdc25B antibody</p>

<p>TRAIL receptor 2 antibody was raised in rabbit using N terminus of the human TRAIL-R2 protein as the immunogen.</p>

<p>Sheep polyclonal Methadol antibody</p>

<p>Rabbit polyclonal JunD antibody</p>

<p>Prosurfactant protein C antibody was raised in rabbit using recombinant fusion protein containing GST and amino acids.. 1-20 from the n-terminal of the human SP-C proprotein as the immunogen.</p>

<p>The IGF-1R antibody is a powerful tool in the field of Life Sciences. It is an anti-HER2 antibody that targets the insulin-like growth factor-1 receptor (IGF-1R). This antibody has been extensively studied and validated for its effectiveness in various applications.</p>

<p>The SEK1 antibody is a polyclonal antibody that specifically targets the amino-terminal region of the natriuretic peptide receptor A (NPRA). It is commonly used in life sciences research and assays to detect and quantify NPRA in various biological samples. The SEK1 antibody can be used for applications such as immunoblotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).</p>

<p>RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD</p>

<p>Rabbit anti-goat IgG (H + L) (biotin) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>Rabbit anti-human IgA (Rhodamine) was raised in rabbit using human IgA alpha chain as the immunogen.</p>

<p>Sheep polyclonal Clostebol antibody</p>

<p>Transferrin antibody was raised in rabbit using murine transferrin as the immunogen.</p>

<p>Rabbit anti-mouse IgG1 was raised in rabbit using murine IgG1 heavy chain as the immunogen.</p>

<p>Goat anti-rabbit IgG (Fab'2) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>Rabbit anti-rat IgG (H+L) (biotin) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>Goat anti-Human IgG (Alk Phos) was raised in goat using purified Human IgG, as the immunogen.</p>

<p>BAI1 antibody was raised in rabbit using a synthetic peptide conjugated to KLHd as the immunogen.</p>

<p>Donkey anti-rabbit IgG (H+L) (biotin) was raised in donkey using rabbit IgG, whole molecule as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. It has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in</p>

<p>The MKK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to alpha-fetoprotein, a glycoprotein that plays a crucial role in various biological processes. This antibody can be used in a variety of assays, including immunohistochemistry and Western blotting, to detect and quantify the presence of alpha-fetoprotein in samples.</p>

<p>DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The FAK antibody is a highly specialized antibody that targets CD33, a protein found on the surface of certain cells. This antibody belongs to the class of antibodies known as polyclonal antibodies, which means it is produced by multiple B cell clones and recognizes different epitopes of the target protein. The FAK antibody has inhibitory properties, meaning it can block or reduce the activity of CD33.</p>

<p>Norfentanyl antibody is a highly specialized monoclonal antibody that is used to inhibit the activity of norfentanyl, a potent phosphatase inhibitor. This antibody specifically targets the amide group of norfentanyl and neutralizes its effects on cellular growth factors. It has been shown to effectively block the activation of tyrosine kinase receptors and prevent the binding of autoantibodies to growth hormone receptors. Norfentanyl antibody is widely used in life sciences research and has significant applications in studying cellular signaling pathways and understanding the role of growth factors in various physiological processes.</p>

<p>FNIP1 Antibody</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA</p>

<p>The Tau antibody is a highly specialized and potent tool used in the field of Life Sciences. It is a nuclear, buffered reaction solution that contains Polyclonal Antibodies, monoclonal antibodies, and conjugate compounds. The Tau antibody specifically targets and binds to tau proteins, which are associated with neurodegenerative diseases such as Alzheimer's disease.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Rabbit polyclonal PI3K P85 antibody</p>

<p>The Methylprednisolone antibody is a monoclonal antibody that falls under the category of Life Sciences. This hormone peptide antibody specifically targets and binds to methylprednisolone, a steroid hormone. It has a glycan structure that plays a crucial role in neutralizing the effects of methylprednisolone.</p>

<p>TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY</p>

<p>Donkey ant-mouse IgG (H + L) secondary antibody biotin</p>

<p>Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.</p>

<p>The FKHR antibody is a powerful growth factor and hormone peptide that plays a crucial role in various biological processes. It is commonly used in research and diagnostics to detect the presence of FKHR in samples.</p>

<p>Pan hair keratins antibody was raised in Guinea Pig using synthetic peptides common to human type I (acidic) andtype II (basic) hair (trichocytic) keratins K31-K40, both coupled to KLH as the immunogen.</p>