Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,606 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,727 products)
- Metabolism Antibodies(277 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GPR37 antibody
<p>GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Mouse anti Rat IgG (H + L) (HRP)
<p>Rat IgG antibody was raised in mouse using Rat IgG (H + L) as the immunogen.</p>Purity:Min. 95%AAV5 antibody
<p>AAV5 antibody was raised in rabbit using residues 530-541 [NSQPANPGTTATC] of 80 kDa capsid VP3 protein of AAV 5 as the immunogen.</p>Purity:Min. 95%Insulin + Proinsulin antibody
<p>Insulin/Proinsulin antibody was raised in guinea pig using synthetic human proinsulin as the immunogen.</p>Purity:Min. 95%PAK1 antibody
<p>The PAK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the PAK1 protein, which plays a crucial role in various cellular processes such as chemokine signaling, endothelial growth, and cell migration. This antibody is widely used in studies investigating the mechanisms of cell growth and development.</p>Purity:Min. 95%Aml1 antibody
<p>The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.</p>Purity:Min. 95%HSFY2 antibody
<p>HSFY2 antibody was raised in rabbit using the C terminal of HSFY2 as the immunogen</p>Purity:Min. 95%Twist 1 antibody
<p>The Twist 1 antibody is a polyclonal antibody that has neutralizing properties against the growth factor Twist 1. This antibody specifically targets and inhibits the activity of Twist 1, a transcription factor involved in cell differentiation and embryonic development. By blocking the function of Twist 1, this antibody can prevent abnormal cell growth and promote normal cellular processes.</p>Purity:Min. 95%MBP antibody
<p>The MBP antibody is a drug antibody that specifically targets and binds to the myelin basic protein (MBP). This protein plays a crucial role in the structure and function of myelin, which is essential for proper nerve conduction. The MBP antibody is available as both polyclonal antibodies and monoclonal antibodies.</p>Purity:Min. 95%ATF2 antibody
<p>The ATF2 antibody is a highly specialized antibody that targets the vascular endothelial growth factor (VEGF), a key growth factor involved in angiogenesis. This antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its signaling pathway, thereby suppressing the growth and proliferation of cancer cells. Additionally, the ATF2 antibody has been shown to induce apoptosis, or programmed cell death, in cancer cells by activating the fas-mediated apoptosis pathway. This monoclonal antibody is produced using state-of-the-art techniques and is highly specific for its target antigen. It can be used for various research applications, including immunohistochemistry, western blotting, and flow cytometry. The ATF2 antibody is a valuable tool for researchers studying cancer biology and developing novel therapeutic strategies against cancer.</p>Purity:Min. 95%Goat anti Rat IgG (H + L) (Texas Red)
<p>Goat anti-rat IgG (H+L) was raised in goat using rat IgG whole molecule as the immunogen.</p>Purity:Min. 95%Goat anti Human IgA (α chain) (FITC)
<p>Goat anti-Human IgA (alpha chain) (FITC) was raised in goat using purified Human IgA as the immunogen.</p>Purity:Min. 95%Human Growth Hormone antibody
<p>Human growth hormone antibody was raised in rabbit using hGH as the immunogen.</p>Purity:Min. 95%GPR21 antibody
<p>GPR21 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%GPR81 antibody
<p>GPR81 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%BRD4 antibody
<p>BRD4 antibody was raised in rabbit using the C terminal of BRD4 as the immunogen</p>Purity:Min. 95%Goat anti Human IgA (α chain) (FITC)
<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>Rabbit anti Sheep IgG (FITC)
<p>Rabbit anti-sheep IgG (FITC) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%IGF-1R antibody
<p>The IGF-1R antibody is a powerful tool in the field of Life Sciences. It specifically targets the insulin-like growth factor-1 receptor, an important protein involved in cell growth and development. This antibody can be used in various research applications, including immunofluorescence, Western blotting, and immunohistochemistry.</p>Purity:Min. 95%Enkephalin antibody
<p>Enkephalin antibody was raised in rabbit using synthetic met-enkephalin (Sigma) conjugated toBSA as the immunogen.</p>Purity:Min. 95%ApoH antibody
<p>ApoH antibody was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.</p>Purity:Min. 95%Dag1 antibody
<p>Dag1 antibody was raised in rabbit using the C terminal of Dag1 as the immunogen</p>Purity:Min. 95%Rabbit anti Whole Bovine serum antibody (IgG fraction)
<p>Whole bovine serum antibody (IgG fraction) was raised in rabbit using bovine serum as the immunogen.</p>Purity:Min. 95%TRF3 antibody
<p>TRF3 antibody was raised in rabbit using the N terminal of TRF3 as the immunogen</p>Purity:Min. 95%FKHR antibody
<p>FKHR antibody is a growth factor that acts as a protein kinase. This antibody specifically targets FKHR, which is involved in various cellular processes such as cell growth, proliferation, and survival. The effective dose of this monoclonal antibody has been determined through extensive research and testing. FKHR antibody has been shown to have a high affinity for fatty acids and can effectively inhibit the binding of these molecules to their respective receptors. Additionally, this antibody has demonstrated the ability to block the activity of epidermal growth factor and collagen, two key regulators of cell function. Polyclonal antibodies targeting FKHR have also been developed and can be used for diagnostic purposes. These antibodies are colloidal in nature and have shown excellent specificity and sensitivity when used in assays such as immunohistochemistry or ELISA. Furthermore, FKHR antibody has been found to modulate the expression of chemokines and transforming growth factor-beta (TGF-beta), suggesting its potential role in immune regulation and inflammation control.</p>Purity:Min. 95%Notch 2 homolog antibody
<p>Notch 2 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 2 (NOTCH2) protein as the immunogen.</p>Purity:Min. 95%Chicken anti Rabbit IgG (H + L) (Alk Phos)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Vaccinia virus antibody
<p>Vaccinia virus antibody was raised in rabbit using New York City Board of Health (NYCBOH) strain as the immunogen.</p>Purity:Min. 95%Goat anti Rat IgG (H + L) (Fab'2) (PE)
<p>Goat anti-rat IgG (H + L) (Fab'2) (PE) was raised in goat using rat IgG whole molecule as the immunogen.</p>Purity:Min. 95%Chk2 antibody
<p>The Chk2 antibody is a highly specialized antibody that targets cholinergic receptors in the body. It is commonly used in research and diagnostic applications to study the role of cholinergic signaling in various physiological processes. This antibody specifically recognizes and binds to the Chk2 protein, which is a key regulator of cell cycle checkpoints and DNA repair mechanisms.</p>Purity:Min. 95%SUN2 Antibody
<p>The SUN2 Antibody is a high-quality polyclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets SUN2, a protein involved in various cellular processes. With its strong affinity and specificity, this antibody allows for precise detection and analysis of SUN2 in different samples.</p>Purity:Min. 95%Rabbit anti Goat IgG (H + L) (Alk Phos)
<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Purity:Min. 95%PKM2 antibody
<p>The PKM2 antibody is a monoclonal antibody that has been developed for use in various research applications. It specifically targets the PKM2 protein, which plays a crucial role in glycolysis and tumorigenesis. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>Purity:Min. 95%Goat anti Mouse IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG.</p>Purity:Min. 95%Carbamazepine antibody
<p>Carbamazepine antibody is a powerful tool used in immunoassays for the detection and quantification of carbamazepine, a commonly prescribed medication. This antibody specifically recognizes and binds to carbamazepine molecules, allowing for accurate measurement in various biological samples. It can be used to isolate nucleic acids or other target molecules that are associated with carbamazepine metabolism or response.</p>Purity:Min. 95%SLC10A1 antibody
<p>SLC10A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY</p>Purity:Min. 95%CDK5 antibody
<p>CDK5 antibody was raised in rabbit using the C terminal of CDK5 as the immunogen</p>Purity:Min. 95%Dhrs3 antibody
<p>Dhrs3 antibody was raised in rabbit using the middle region of Dhrs3 as the immunogen</p>Purity:Min. 95%Rb antibody
<p>The Rb antibody is a monoclonal antibody that targets the growth factor receptor trastuzumab. It belongs to the class of antibodies known as chemokines, which are involved in immune responses. This antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activity. In addition to its role in cancer therapy, this antibody has also been used in life sciences research for its ability to neutralize cytotoxic effects of certain proteins, such as anti-acth antibodies and TGF-beta. The Rb antibody has shown efficacy against various pathogens, including Mycoplasma genitalium.</p>Purity:Min. 95%RAD17 antibody
<p>RAD17 antibody was raised in rabbit using the C terminal of RAD17 as the immunogen</p>Purity:Min. 95%ATF2 antibody
<p>The ATF2 antibody is a highly specialized antibody that targets the ATF2 protein. This protein plays a crucial role in regulating cell growth and division, making it an important target for cancer research. The ATF2 antibody specifically binds to the ATF2 protein, inhibiting its activity and preventing it from promoting cell proliferation.</p>Purity:Min. 95%Rabbit anti Human IgM (biotin)
<p>Rabbit anti-human IgM (biotin) was raised in rabbit using human IgM (Fc5mu) fragment as the immunogen.</p>Purity:Min. 95%GABRB3 antibody
<p>GABRB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA</p>Purity:Min. 95%GPR3 antibody
<p>GPR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%SMAD3 antibody
<p>The SMAD3 antibody is a highly specialized product used in the field of life sciences. It belongs to the group of polyclonal antibodies and is widely recognized for its high specificity and sensitivity. This antibody is commonly used in various assays, including immunohistochemistry, western blotting, and ELISA.</p>Purity:Min. 95%Goat anti Human IgG (H + L) (Fab'2) (FITC)
<p>Goat anti-human IgG (H+L) (Fab'2) (FITC) was raised in goat using human IgG whole molecule as the immunogen.</p>Purity:Min. 95%STAT5A antibody
<p>The STAT5A antibody is a monoclonal antibody that specifically targets the STAT5A protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival. The STAT5A antibody can be used in research and diagnostics to study the activation and expression of STAT5A.</p>Purity:Min. 95%Donkey anti Sheep IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>Purity:Min. 95%CAV1 antibody
<p>The CAV1 antibody is a growth factor that has multidrug and interferon properties. It is widely used in the field of Life Sciences for its neuroprotective effects. This antibody specifically targets vasoactive intestinal peptide (VIP) binding proteins, which play a crucial role in various cellular processes. The CAV1 antibody can be used in research studies to detect and measure the levels of VIP binding proteins in samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The low-molecular-weight nature of this antibody allows for efficient penetration into cells, ensuring accurate detection and analysis. Additionally, the CAV1 antibody has been shown to possess neutralizing activity against certain factors, making it a valuable tool in various experimental settings. Researchers can rely on the high-quality performance of this antibody to obtain reliable and reproducible results for their studies.</p>Purity:Min. 95%Rabbit anti Human IgG
<p>Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Goat anti Bovine IgG (H + L) (FITC)
<p>Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.</p>Purity:Min. 95%FCRL4 antibody
<p>FCRL4 antibody was raised using the N terminal of FCRL4 corresponding to a region with amino acids FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR</p>Purity:Min. 95%CCKA Receptor antibody
<p>CCKA Receptor antibody was raised in rabbit using synthetic peptide from the C-terminus of rat CCKA receptor conjugated to BSA as the immunogen.</p>Purity:Min. 95%CCR7 antibody
<p>The CCR7 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to the activated form of CCR7, a chemokine receptor involved in immune cell migration. This antibody is derived from human serum and is widely used for research purposes.</p>Purity:Min. 95%BRS3 antibody
<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Xanthine Oxidase antibody
<p>Xanthine oxidase antibody was raised in rabbit using xanthine oxidase isolated from bovine buttermilk as the immunogen.</p>Purity:Min. 95%Goat anti Human IgM (mu chain)
<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>Purity:Min. 95%Mouse Lymphocyte antibody
<p>Mouse lymphocyte antibody was raised in rabbit using RBC-free rannit thymus and spleen cells as the immunogen.</p>Purity:Min. 95%PNMT antibody
<p>PNMT antibody was raised in guinea pig using phenylethanolamine-N-methyltransferase from bovine adrenal medulla as the immunogen.</p>Purity:Min. 95%DSCAM antibody
<p>DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV</p>Purity:Min. 95%Treponema pallidum antibody
<p>Treponema pallidum antibody was raised in rabbit using highly purified Treponema pallidum as the immunogen.</p>Purity:Min. 95%ITFG1 antibody
<p>ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP</p>Purity:Min. 95%Donkey anti Rat IgG (H + L)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Purity:Min. 95%Goat anti Rat IgG (H + L)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Purity:Min. 95%IL1 α antibody
<p>IL1 alpha antibody was raised in goat using highly pure recombinant rat IL-1a as the immunogen.</p>Purity:Min. 95%ZNF709 antibody
<p>ZNF709 antibody was raised in rabbit using the N terminal of ZNF709 as the immunogen</p>Purity:Min. 95%STAT3 antibody
<p>The STAT3 antibody is a monoclonal antibody that specifically targets the cytokine family. It has been extensively studied and validated using mass spectroscopy techniques in Life Sciences research. This antibody is designed to detect activated STAT3 in nuclear extracts, making it an essential tool for studying signaling pathways involving this transcription factor. The STAT3 antibody has been used in various applications such as chromatin immunoprecipitation assays to investigate its DNA binding activity and its role in gene regulation. Additionally, this antibody has shown anti-thrombotic properties and has been implicated in oxygen therapy research. Whether you're conducting basic research or exploring therapeutic avenues, the STAT3 antibody is a valuable tool for your studies. Choose from our range of high-quality monoclonal and polyclonal antibodies to meet your specific research needs.</p>Purity:Min. 95%ISL2 antibody
<p>ISL2 antibody was raised in rabbit using the C terminal of ISL2 as the immunogen</p>Purity:Min. 95%Goat anti Human κ Chain
<p>Goat anti-human kappa chain was raised in goat using human kappa light chain as the immunogen.</p>Purity:Min. 95%NAPE-PLD antibody
<p>NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV</p>Vesicular GABA Transporter antibody
<p>Vesicular GABA Transporter antibody was raised in rabbit using synthetic peptide from the C-terminus of human VGAT coupled to BSA as the immunogen.</p>Purity:Min. 95%FASLG antibody
<p>FASLG antibody was raised in rabbit using the middle region of FASLG as the immunogen</p>Purity:Min. 95%Acidic hair keratin K31 antibody
<p>acidic hair keratin K31 antibody was raised in Guinea Pig using Complete recombinant human hair (trichocytic) keratin K31 coupled to KLH as the immunogen.</p>Purity:Min. 95%PYGB antibody
<p>PYGB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%ZNF534 antibody
<p>ZNF534 antibody was raised in rabbit using the middle region of ZNF534 as the immunogen</p>Purity:Min. 95%Rabbit anti Cat IgG (biotin)
<p>Rabbit anti-cat IgG (biotin) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%POFUT1 antibody
<p>POFUT1 antibody was raised in rabbit using the middle region of POFUT1 as the immunogen</p>Purity:Min. 95%Rabbit anti Bovine IgG (biotin)
<p>Rabbit anti-bovine IgG (biotin) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (FITC)
<p>Donkey anti-rabbit IgG (H+L) (FITC) was raised in donkey using rabbit IgG, whole molecule as the immunogen.</p>Purity:Min. 95%Met antibody
<p>The Met antibody is a highly activated antibody that targets the hepatocyte growth factor receptor, also known as Met. It plays a crucial role in various cellular processes such as cell growth, survival, and migration. The Met antibody has been extensively studied for its potential therapeutic applications in cancer treatment.</p>Purity:Min. 95%EGFR antibody
<p>The EGFR antibody is a highly specialized Polyclonal Antibody that acts as a family kinase inhibitor. It is designed to target and inhibit the epidermal growth factor receptor (EGFR), which plays a crucial role in cell growth and division. This antibody is particularly effective against HER2-positive cancers, as it specifically targets the HER2 receptor.</p>Purity:Min. 95%Rex1 antibody
<p>The Rex1 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in assays and immunohistochemical studies to detect the presence of Rex1, a protein expressed in pluripotent stem cells. This antibody has been shown to be highly specific and sensitive, making it an ideal tool for studying the properties and behavior of stem cells. Additionally, the Rex1 antibody can be used as an inhibitor to block the activity of Rex1, allowing researchers to investigate its function and role in cellular processes. Its application extends beyond basic research, as it has potential uses in the development of new medicines and therapies targeting pluripotent stem cells. With its unique ability to recognize and bind to Rex1, this antibody offers valuable insights into the complex mechanisms underlying cell differentiation and development.</p>Purity:Min. 95%p53 antibody
<p>The p53 antibody is a monoclonal antibody that specifically targets and binds to the p53 protein. This protein plays a crucial role in regulating cell growth and preventing tumor formation. By binding to p53, the antibody can help researchers and scientists study the function and expression of this important protein.</p>Purity:Min. 95%Melanoma-associated antigen D1 antibody
<p>Rabbit polyclonal Melanoma-associated antigen D1 antibody</p>Purity:Min. 95%Goat anti Pig IgG (H + L)
<p>Goat anti-pig IgG (H + L) was raised in goat using porcine IgG, (H & L) as the immunogen.</p>Purity:Min. 95%Goat anti Human κ Chain (biotin)
<p>Goat anti-human kappa chain (biotin) was raised in goat using human kappa chain as the immunogen.</p>Purity:Min. 95%DARPP32 antibody
<p>The DARPP32 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of DARPP32, a protein involved in dopamine signaling and growth factor regulation. This antibody has been extensively tested and validated for its specificity and efficacy in various research applications.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Rabbit anti Cat IgG
<p>Rabbit anti-cat IgG was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Goat anti Cat IgG (rhodamine)
<p>Goat anti-cat IgG (Rhodamine) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Goat anti Mouse IgM (Texas Red)
<p>Goat anti-mouse IgM was raised in goat using murine IgM mu chain as the immunogen.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L)
<p>Goat anti Rabbit IgG (H + L) secondary antibody; 2 mg/ml; ELISA, ICC, IHC, WB; Does not crossreact with non-immunoglobulin serum proteins. Has minimum cross reactivity with bovine, horse, mouse and rat serum proteins</p>Purity:Min. 95%Rabbit anti Mouse IgM (rhodamine)
<p>Rabbit anti-mouse IgM (Rhodamine) was raised in rabbit using murine IgM heavy chain as the immunogen.</p>Purity:Min. 95%AF594 Rabbit anti Chicken IgY (H + L)
<p>Rabbit anti Chicken IgY (H + L) secondary antibody with AF594 photostable fluorescent dye label.</p>Purity:Min. 95%ESA antibody
<p>The ESA antibody is a monoclonal antibody that specifically targets erythropoietin (EPO) and its receptor. It has been shown to have a high affinity for EPO and effectively inhibits the binding of EPO to its receptor. This antibody is commonly used in life sciences research to study the role of EPO in various biological processes.</p>Purity:Min. 95%ApoJ antibody
<p>ApoJ antibody was raised in goat using human apolipoprotein type J as the immunogen.</p>Purity:Min. 95%C20ORF116 antibody
<p>C20ORF116 antibody was raised using the middle region of C20Orf116 corresponding to a region with amino acids EERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKL</p>Purity:Min. 95%SGK3 antibody
<p>SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Rabbit anti Chicken IgG (H + L) (HRP)
<p>Rabbit anti-chicken IgG (H+L) (HRP) was raised in rabbit using chicken IgG whole molecule as the immunogen.</p>Purity:Min. 95%Keratin K75 antibody
<p>Keratin K75 antibody was raised in Guinea Pig using synthetic peptide of human type II keratin K75 coupled to KLH as the immunogen.</p>Sheep anti Rabbit IgG (H + L) (biotin)
<p>Sheep anti-rabbit IgG (H+L) (biotin) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>Purity:Min. 95%KIF21A antibody
<p>KIF21A antibody was raised using the N terminal of KIF21A corresponding to a region with amino acids KEKRKKKSVAGKEDNTDTDQEKKEEKGVSERENNELEVEESQEVSDHEDE</p>Purity:Min. 95%Goat anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%CEACAM3 antibody
<p>CEACAM3 antibody was raised in rabbit using the C terminal of CEACAM3 as the immunogen</p>Purity:Min. 95%Goat anti Rabbit IgG (rhodamine)
<p>Goat anti-rabbit IgG (Rhodamine) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Donkey anti Sheep IgG (H + L) (HRP)
<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>Purity:Min. 95%Donkey anti Sheep IgG (H + L) (FITC)
<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>Purity:Min. 95%Cu/Zn SOD antibody
<p>Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.</p>Purity:Min. 95%FAK antibody
<p>The FAK antibody is a protein that belongs to the Life Sciences category and falls under the Polyclonal Antibodies group. It is specifically designed to target nuclear proteins, including sclerostin and proteinase. This antibody works by binding to specific polypeptide sequences, allowing for accurate detection and analysis in various assays.</p>Purity:Min. 95%Methamphetamine antibody
<p>Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.</p>DNER antibody
<p>DNER antibody was raised in rabbit using the middle region of DNER as the immunogen</p>Purity:Min. 95%PYGL antibody
<p>PYGL antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%THRA antibody
<p>THRA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Goat anti Bovine IgG (rhodamine)
<p>Goat anti-bovine IgG (Rhodamine) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%GPR1 antibody
<p>GPR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Rat anti Mouse IgG1
<p>Rat anti Mouse IgG1 is a globulin-based antibody that is commonly used in Life Sciences research. It is specifically designed to neutralize and bind to Mouse IgG1 antibodies, making it an essential tool for various laboratory applications. This antibody-drug has been extensively tested and validated for its high specificity and potency. It can be used as a secondary antibody in immunoassays such as ELISA, Western blotting, and immunohistochemistry. Rat anti Mouse IgG1 has been proven to effectively detect and quantify target proteins, hormones, enzymes, chemokines, and other biomolecules of interest. With its exceptional performance and reliable results, this antibody is a valuable asset for researchers in the field of Life Sciences.</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a medicament that belongs to the class of globulin-based drugs. It is a polyclonal antibody that has been specifically designed to target and neutralize the activity of Tau protein. Tau protein plays a crucial role in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, by forming abnormal aggregates in the brain.</p>Purity:Min. 95%PDE7B antibody
<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Calcitonin antibody
<p>Calcitonin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Luciferase antibody
<p>The Luciferase antibody is a highly specialized neutralizing antibody complex used in Life Sciences research. It plays a crucial role in the study of lipid peroxidation, cholinergic signaling, and luciferase catalyzed reactions. This Polyclonal Antibody is designed to target specific luciferases and inhibit their activity, allowing researchers to accurately measure and analyze various biological processes. The Luciferase antibody has been extensively tested and validated for use in liver microsomes, rat liver microsomes, and other relevant samples. Its high specificity ensures minimal interference with other cellular components, providing accurate results for experiments involving interleukin-6, interferon, and other important biomolecules. With its ability to neutralize luciferase activity and facilitate lysis of target cells, this monoclonal antibody is an invaluable tool for scientists working in the field of molecular biology and biochemistry.</p>Purity:Min. 95%SOX2 antibody
<p>The SOX2 antibody is a powerful tool used in Life Sciences research. It is specifically designed to target and bind to the SOX2 protein, which plays a crucial role in cellular development and differentiation. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>Purity:Min. 95%Rabbit anti Guinea Pig IgG (H + L) (FITC)
<p>Rabbit anti-guinea pig IgG (H+L) (FITC) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>Purity:Min. 95%MAFF antibody
<p>MAFF antibody was raised in rabbit using the N terminal of MAFF as the immunogen</p>Purity:Min. 95%Heroin antibody
<p>The Heroin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to heroin, an opioid drug derived from morphine. This antibody can be used for various applications, including research, diagnostics, and therapeutic purposes.</p>Purity:Min. 95%Capping Protein β 3 antibody
<p>Capping Protein beta 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine F-actin Beta 3 subunit capping protein coupled to KLH as the immunogen.</p>Purity:Min. 95%Fatty Acid Synthase antibody
<p>The Fatty Acid Synthase antibody is a polyclonal antibody that specifically targets the biomolecule involved in fatty acid synthesis. This antibody has been shown to be activated by interferon and can effectively neutralize the target molecule, making it a valuable tool in life sciences research. It has been used in various applications such as electrode coating, collagen staining, and immunohistochemistry. Additionally, this antibody has shown binding affinity to galectin-3, another important biomolecule. With its high specificity and versatility, the Fatty Acid Synthase antibody is an essential component for any researcher studying lipid metabolism or investigating related diseases.</p>Purity:Min. 95%TRIM23 antibody
<p>TRIM23 antibody was raised in rabbit using the C terminal of TRIM23 as the immunogen</p>Purity:Min. 95%Chicken anti Rabbit IgG (H + L) (HRP)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Histidine Decarboxylase antibody
<p>Histidine decarboxylase antibody was raised in rabbit using recombinant histidine decarboxylase produced in E. Coli as the immunogen.</p>Purity:Min. 95%Keratin K18 antibody
<p>Keratin K18 antibody was raised in Guinea Pig using synthetic peptide from human keratin K18 as the immunogen.</p>Purity:Min. 95%Rabbit anti Goat IgG (H + L) (Texas Red)
<p>Rabbit anti-goat IgG (H+L) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Purity:Min. 95%Cytokeratin 8 +18 antibody
<p>Cytokeratin 8/8 antibody was raised in guinea pig using cytokeratin 8/18 filaments, reconstituted from purified bovine cytokeratins 8 and 18 as the immunogen.</p>KCNH3 antibody
<p>KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET</p>Purity:Min. 95%GLUT1 antibody
<p>GLUT1 antibody was raised in rabbit using a 12 amino acid peptide of the C-terminus of hGLUT-1 conjugated to KLH as the immunogen.</p>Purity:Min. 95%Rat Thymocyte antibody
<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.</p>Purity:Min. 95%Rabbit anti Goat IgG (Texas Red)
<p>Rabbit anti-goat IgG was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Plk3 antibody
<p>Plk3 antibody was raised in rabbit using the C terminal of Plk3 as the immunogen</p>Purity:Min. 95%Rabbit anti Human IgG (FITC)
<p>Rabbit anti-human IgG (FITC) was raised in rabbit using human IgG g gamma chain as the immunogen.</p>Purity:Min. 95%Rabbit anti Sheep IgG (biotin)
<p>Rabbit anti-sheep IgG (biotin) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Goat anti Rat IgG (H + L) (HRP)
<p>Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.</p>Purity:Min. 95%Rabbit anti Rat IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Purity:Min. 95%Caspase 10 antibody
<p>Caspase 10 antibody was raised in rabbit using N terminal sequence MKSQGQHWYSSSDKN of all isoforms of human caspase-10 as the immunogen.</p>Purity:Min. 95%HER2 antibody
<p>The HER2 antibody is a monoclonal antibody that specifically targets and binds to the HER2 protein, which is overexpressed in certain types of cancer cells. This antibody has cytotoxic effects on cancer cells, leading to their destruction. The HER2 antibody contains a carbonyl group and an amino group, which are essential for its binding activity. It can be used in combination with other therapies, such as chemotherapy or radiation, to enhance treatment outcomes.</p>Purity:Min. 95%PTDSR antibody
<p>PTDSR antibody was raised in rabbit using the C terminal of PTDSR as the immunogen</p>Purity:Min. 95%Goat anti Human IgG (H + L) (Texas Red)
<p>Goat anti-human IgG (H+L) was raised in goat using human IgG, whole molecule as the immunogen.</p>Purity:Min. 95%Chicken anti Human IgG (H + L)
<p>Chicken anti Human IgG (H + L) secondary antibody</p>Purity:Min. 95%Dopamine D2 Receptor antibody
<p>Dopamine D2 receptor antibody was raised in rabbit using an 11 amino acid peptide of rat D2R as the immunogen.</p>Purity:Min. 95%KHDRBS1 antibody
<p>KHDRBS1 antibody was raised in rabbit using the N terminal of KHDRBS1 as the immunogen</p>Purity:Min. 95%p27Kip1 antibody
<p>The p27Kip1 antibody is a highly specific and potent neutralizing antibody that targets the p27Kip1 protein. This protein plays a crucial role in cell cycle regulation and acts as a tumor suppressor. The p27Kip1 antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic tool for cancer treatment.</p>Purity:Min. 95%PRPSAP2 antibody
<p>PRPSAP2 antibody was raised in rabbit using the middle region of PRPSAP2 as the immunogen</p>Purity:Min. 95%DDR1 antibody
<p>DDR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Rat Mast Cells antibody
<p>Rat mast cells antibody was raised in rabbit using rat mast cells as the immunogen.</p>Purity:Min. 95%TIP47 antibody
<p>TIP47 antibody was raised in guinea pig using synthetic peptide of TIP47 N-terminus as the immunogen.</p>Purity:Min. 95%SMAD2 antibody
<p>The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.</p>Purity:Min. 95%Chlamydia trachomatis antibody
<p>Chlamydia trachomatis antibody was raised in goat using purified MOMP from strain L2 as the immunogen.</p>Purity:Min. 95%cSRC antibody
<p>The cSRC antibody is a valuable tool in the field of Life Sciences. It is widely used as an inhibitor for 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody specifically targets and binds to the phosphorylation site of cSRC, a protein kinase that plays a crucial role in cell signaling pathways.</p>Purity:Min. 95%Hpn antibody
<p>Hpn antibody was raised in Rabbit using Human Hpn as the immunogen</p>Purity:Min. 95%TIRAP antibody
<p>TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW</p>Purity:Min. 95%KBTBD10 antibody
<p>KBTBD10 antibody was raised in rabbit using the C terminal of KBTBD10 as the immunogen</p>Purity:Min. 95%Goat anti Rabbit IgG (rhodamine)
<p>Goat anti-rabbit IgG (Rhodamine) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Donkey anti Rat IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Purity:Min. 95%NEK2 Antibody
<p>The NEK2 Antibody is a highly effective tool for researchers in the field of life sciences. This monoclonal antibody specifically targets NEK2, a protein involved in cell cycle regulation and tumor growth. By inhibiting NEK2 activity, this antibody can potentially halt the progression of various types of cancer.</p>Purity:Min. 95%Goat anti Mouse IgG (H + L) (FITC)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%ZNHIT3 antibody
<p>ZNHIT3 antibody was raised in rabbit using the N terminal of ZNHIT3 as the immunogen</p>Purity:Min. 95%PLAGL1 antibody
<p>PLAGL1 antibody was raised in rabbit using the N terminal of PLAGL1 as the immunogen</p>Purity:Min. 95%SERINC2 antibody
<p>SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS</p>Purity:Min. 95%ADORA1 antibody
<p>ADORA1 antibody was raised in rabbit using the C terminal of ADORA1 as the immunogen</p>Purity:Min. 95%Goat anti Human IgE (ε chain) (biotin)
<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>Purity:Min. 95%Goat anti Human κ chain
<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>Purity:Min. 95%CCR10 antibody
<p>CCR10 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%TRAIL Receptor 3 antibody
<p>TRAIL receptor 3 antibody was raised in rabbit using N terminus of the mature human TRAIL-R3 protein as the immunogen.</p>Purity:Min. 95%Goat anti Mouse IgG (Fab'2)
<p>Goat anti-mouse IgG (Fab'2) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Rabbit anti Cat IgG (Texas Red)
<p>Rabbit anti-cat IgG was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Goat anti Human IgG (rhodamine)
<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a specific antibody used in Life Sciences research. It is designed to target and bind to tau proteins, which are involved in the pathogenesis of neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has been extensively characterized and validated for its high specificity and sensitivity in detecting tau protein aggregates.</p>Purity:Min. 95%GJA3 antibody
<p>GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS</p>Purity:Min. 95%Granzyme K antibody
<p>Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK</p>Purity:Min. 95%Rabbit anti Cat IgG (H + L) (Texas Red)
<p>Rabbit anti-cat IgG (H+L) was raised in rabbit using feline IgG whole molecule as the immunogen.</p>Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Dihydrotestosterone antibody
<p>The Dihydrotestosterone antibody is an anti-connexin agent that is used in Life Sciences research. It is a monoclonal antibody that specifically targets dihydrotestosterone, a hydrogen atom variant of testosterone. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications. It can be used in techniques such as particle chemiluminescence and electrode-based assays to detect and quantify dihydrotestosterone levels. Additionally, this antibody has shown potential for use in studying the role of dihydrotestosterone in various biological processes, including helicobacter infection and TGF-beta signaling pathways. With its high affinity and specificity, the Dihydrotestosterone antibody is a valuable tool for researchers studying hormone-related disorders and exploring new therapeutic strategies.</p>Purity:Min. 95%Rabbit anti Bovine IgG (H + L) (FITC)
<p>Rabbit anti-bovine IgG (H+L) (FITC) was raised in rabbit using bovine IgG, whole molecule as the immunogen.</p>Purity:Min. 95%B4GALNT1 antibody
<p>B4GALNT1 antibody was raised using the N terminal of B4GALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG</p>Purity:Min. 95%
