Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,606 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,761 products)
- Metabolism Antibodies(277 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FAK antibody
<p>The FAK antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to Focal Adhesion Kinase (FAK), a protein involved in various cellular processes. By inhibiting the activity of FAK, this antibody can modulate signaling pathways that are crucial for cell migration, adhesion, and proliferation.</p>Purity:Min. 95%ATF2 antibody
<p>The ATF2 antibody is a highly specialized immunogenic composition that belongs to the family of monoclonal antibodies. It is specifically designed to target and inhibit the activity of ATF2, a protein kinase involved in various cellular processes. This antibody has been extensively studied and proven to effectively block the function of ATF2, making it a valuable tool for researchers studying signal transduction pathways and gene expression regulation.</p>Purity:Min. 95%GAP43 antibody
<p>The GAP43 antibody is a highly specialized product used in the field of Life Sciences. It is a colloidal, activated antibody that specifically targets and binds to GAP43 protein. This protein is found in various cell types, including cardiomyocytes, and plays a crucial role in cellular processes such as chemokine signaling and annexin A2 regulation.</p>Purity:Min. 95%Goat anti Rat IgG (H + L) (HRP)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Purity:Min. 95%Goat anti Monkey IgG (H + L) (Alk Phos)
<p>Goat anti Monkey IgG (H + L) secondary antibody (Alk Phos)</p>Purity:Min. 95%Goat anti Mouse IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%NXPH1 antibody
<p>NXPH1 antibody was raised in rabbit using the N terminal of NXPH1 as the immunogen</p>Purity:Min. 95%Keratin K3 antibody
<p>Keratin K3 antibody was raised in Guinea Pig using synthetic peptide of human keratin K3 coupled to KLH as the immunogen.</p>Purity:Min. 95%Cdx2 antibody
<p>The Cdx2 antibody is a highly specific monoclonal antibody that targets the Cdx2 protein. This protein plays a crucial role in regulating gene expression and cell differentiation in various tissues, including the gastrointestinal tract. The Cdx2 antibody can be used for research purposes in the field of life sciences to study the function and localization of Cdx2.</p>Goat anti Guinea Pig IgG (H + L) (biotin)
<p>Goat anti-Guinea Pig IgG (H + L) (biotin) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.</p>Purity:Min. 95%PRLHR antibody
<p>PRLHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Mouse anti Rat IgG Light Chain (HRP)
<p>IgG Light Chain antibody was raised in Mouse using Rat IgG as the immunogen.</p>Purity:Min. 95%IFN β antibody
<p>IFN beta antibody was raised in rabbit using human interferon beta as the immunogen.</p>Purity:Min. 95%GLIS3 antibody
<p>GLIS3 antibody was raised in rabbit using the C terminal of GLIS3 as the immunogen</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a highly specialized monoclonal antibody that is used in various research applications. This antibody specifically targets and binds to the Tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's disease. The Tau antibody is designed to recognize and bind to specific regions of the Tau protein, allowing for accurate detection and analysis.</p>Purity:Min. 95%Goat anti Donkey IgG (H + L) (biotin)
<p>This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.</p>Purity:Min. 95%Goat anti Human κ chain (Alk Phos)
<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>Purity:Min. 95%Prepro-Neuropeptide Y antibody
<p>Prepro-neuropeptide Y antibody was raised in rabbit using a synthetic Prepro-NPY 68-97 (C-PON) as the immunogen.</p>Purity:Min. 95%PTGER2 antibody
<p>PTGER2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Goat anti Rabbit IgG (Texas Red)
<p>Goat anti-rabbit IgG was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Sheep anti Rabbit IgG (H + L) (Alk Phos)
<p>Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a highly specialized monoclonal antibody that targets the tau protein, which plays a crucial role in the formation of neurofibrillary tangles in Alzheimer's disease. This antibody specifically recognizes and binds to tau protein, preventing its aggregation and promoting its clearance from the brain. It has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials.</p>Purity:Min. 95%PSMD1 antibody
<p>PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE</p>Purity:Min. 95%TTC19 antibody
<p>TTC19 antibody was raised in rabbit using the N terminal of TTC19 as the immunogen</p>Purity:Min. 95%MKK6 antibody
<p>The MKK6 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to MKK6, which is a tyrosine kinase-like enzyme involved in various cellular processes. This antibody is widely used in research and diagnostics for its ability to detect and measure the levels of MKK6 in biological samples.</p>Purity:Min. 95%LIN28B antibody
<p>The LIN28B antibody is a specific monoclonal antibody that has been developed for the detection and study of LIN28B protein. It is widely used in research and diagnostic applications. The LIN28B antibody has high affinity and specificity for its target, allowing for accurate and reliable results. Its disulfide bond structure ensures stability and durability.</p>Purity:Min. 95%PDE7B antibody
<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Streptavidin antibody
<p>The Streptavidin antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets annexin A2, an important protein involved in various cellular processes. By binding to annexin A2, the Streptavidin antibody enables researchers to study and manipulate its functions in both normal and disease conditions.</p>Purity:Min. 95%Plasminogen antibody
<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>Purity:Min. 95%RAB25 antibody
<p>RAB25 antibody was raised in rabbit using the middle region of RAB25 as the immunogen</p>Purity:Min. 95%Histone H3.1 antibody
<p>The Histone H3.1 antibody is a highly effective antiviral agent that targets autoantibodies and interleukins in the body. It has been proven to have a high-flux capability, making it an ideal choice for treating various viral infections. This antibody works by interacting with cation channels and methyl transferase enzymes, effectively inhibiting their activity and preventing viral replication. The Histone H3.1 antibody is available in both monoclonal and polyclonal forms, allowing for personalized treatment options based on individual patient needs. Additionally, this antibody has shown promising results as a biomarker composition in the field of nuclear medicine, making it a valuable tool for diagnostic purposes.</p>Purity:Min. 95%LRRN3 antibody
<p>LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL</p>Purity:Min. 95%Methamphetamine antibody
<p>The Methamphetamine antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the effects of methamphetamine in the body. This antibody has been extensively studied and has shown promising results in various preclinical and clinical trials.</p>Purity:>95%Rabbit anti Llama IgG (H + L) (Alk Phos)
<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>Purity:Min. 95%Adiponectin antibody
<p>The Adiponectin antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to specifically target and bind to adiponectin, a protein hormone involved in various physiological processes. This antibody is commonly used as a test substance in research studies and diagnostic assays to measure the levels of adiponectin in human serum or blood plasma.</p>Purity:Min. 95%Met antibody
<p>Met antibody is an anti-HER2 antibody that belongs to the class of antibodies and inhibitors. It specifically targets β-catenin and inhibits its activity, thereby suppressing the growth and proliferation of cancer cells. Met antibody also inhibits the activity of VEGF-C, a protein involved in endothelial growth and angiogenesis. This antibody has been shown to have synergistic effects when used in combination with trastuzumab, another HER2-targeted therapy. Additionally, Met antibody has been found to interact with fibronectin and collagen, two components of the extracellular matrix, suggesting a potential role in modulating cell adhesion and migration. In life sciences research, Met antibody is commonly used as a tool to study the function of the MET receptor and its downstream signaling pathways.</p>Purity:Min. 95%Goat anti Rabbit IgG (Alk Phos)
<p>Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Goat anti Human IgG (H + L) (FITC)
<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>Purity:Min. 95%PA2G4 antibody
<p>PA2G4 antibody was raised in rabbit using the middle region of PA2G4 as the immunogen</p>Purity:Min. 95%p70S6 Kinase antibody
<p>The p70S6 Kinase antibody is a highly specialized monoclonal antibody that targets the disulfide bond of the p70S6 kinase protein. This antibody has been extensively tested and proven to be cytotoxic, leading to the lysis of cells expressing high levels of p70S6 kinase. It has also been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and cell death.</p>Purity:Min. 95%ZNF417 antibody
<p>ZNF417 antibody was raised in rabbit using the N terminal of ZNF417 as the immunogen</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Texas Red)
<p>Goat anti-rabbit IgG (H+L) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>Purity:Min. 95%Vav antibody
<p>The Vav antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the recombinant antigen found in c2c12 myotubes. This antibody plays a crucial role in immunoassays by facilitating the antigen-antibody reaction, allowing for accurate detection and measurement of specific proteins or molecules. The Vav antibody is known for its neutralizing properties, making it an essential tool in studying protein kinase signaling pathways and autoantibodies. Its high sensitivity and specificity make it ideal for use in particle chemiluminescence and polymerase chain reactions (PCR). Researchers rely on the Vav antibody to provide reliable results in their studies related to steroid metabolism and other important cellular processes.</p>Purity:Min. 95%Donkey anti Goat IgG (H + L) (Texas Red)
<p>Donkey anti-goat IgG (H + L) was raised in donkey using goat IgG whole molecule as the immunogen.</p>Purity:Min. 95%Rat Mast Cells antibody
<p>Rat mast cells antibody was raised in rabbit using rat mast cells as the immunogen.</p>Purity:Min. 95%Fibrillarin antibody
<p>Fibrillarin antibody is a polyclonal antibody that is commonly used in life sciences research. It plays a crucial role in various cellular processes, including epidermal growth factor signaling, collagen synthesis, and transferrin regulation. This antibody has been shown to have neutralizing effects on transforming growth factor-beta (TGF-beta), which is involved in cell proliferation and differentiation. Additionally, it has been used as a tool to study the effects of vasoactive intestinal peptide and ketamine on neuronal activity. Fibrillarin antibody is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications in the field of antibodies and multidrug research.</p>Purity:Min. 95%Goat anti Rat IgG (Fab'2) (PE)
<p>Goat anti-rat IgG (Fab'2) (PE) was raised in goat using rat IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Ezrin antibody
<p>The Ezrin antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to ezrin, a protein that plays a crucial role in cellular processes such as cell adhesion, migration, and signal transduction. By binding to ezrin, this antibody allows researchers to study the function and localization of this protein within cells.</p>Purity:Min. 95%PARP2 antibody
<p>PARP2 antibody was raised in rabbit using residues 43-59 [QRQESKKMPVAGGKANK] of the 62 kDa human PARP-2 protein as the immunogen.</p>Purity:Min. 95%SHP2 antibody
<p>The SHP2 antibody is a monoclonal antibody that specifically targets SHP2, a protein involved in various cellular processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications.</p>Purity:Min. 95%IGFBP3 antibody
<p>The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.</p>Purity:Min. 95%CYP21A2 antibody
<p>CYP21A2 antibody was raised in rabbit using the C terminal of CYP21A2 as the immunogen</p>Purity:Min. 95%DPP9 antibody
<p>DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Goat anti Human IgG (H + L) (biotin)
<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>Purity:Min. 95%ZFP589 antibody
<p>ZFP589 antibody was raised in rabbit using the middle region of ZFP589 as the immunogen</p>Purity:Min. 95%Keratin K2 antibody
<p>Keratin K2 antibody was raised in Guinea Pig using synthetic peptide (N-terminal aa 2-23) of human keratin K2 as the immunogen.</p>Purity:Min. 95%Donkey anti Sheep IgG (H + L) (biotin)
<p>Donkey anti-Sheep IgG (H + L) (biotin) was raised in donkey using purified Sheep IgG (H&L) as the immunogen.</p>Purity:Min. 95%S6K1 antibody
<p>The S6K1 antibody is a highly specialized monoclonal antibody that targets collagen, a crucial protein in various biological processes. This antibody is designed to specifically bind to collagen at low pH levels, making it suitable for a wide range of applications. It is a glycoprotein that can be used in research and diagnostic settings.</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L) (HRP)
<p>Goat anti Rabbit IgG (H + L) secondary antibody (HRP);Does not crossreact with other non-immunoglobulin serum proteins. This antibody has minimum cross reactivity with human, bovine, mouse and horse serum proteins</p>Purity:Min. 95%Rabbit anti Mouse IgG (H + L) (FITC)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%KIF2B antibody
<p>KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK</p>Purity:Min. 95%Mouse Thrombocyte antibody
<p>Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.</p>Purity:Min. 95%ZNF621 antibody
<p>ZNF621 antibody was raised in rabbit using the middle region of ZNF621 as the immunogen</p>Purity:Min. 95%PLCG2 antibody
<p>The PLCG2 antibody is a highly specialized tool used in the field of Life Sciences. It plays a crucial role in various cellular processes by acting as an electrode that activates phosphatase and protein kinase signaling pathways. This antibody is specifically designed to target PLCG2, a key enzyme involved in signal transduction.</p>Purity:Min. 95%Mouse anti Rat IgG2a (HRP)
<p>IgG2a antibody was raised in Mouse using Rat IgG2a as the immunogen.</p>Purity:Min. 95%Donkey anti Sheep IgG (H + L) (Texas Red)
<p>Donkey anti-sheep IgG (H+L) was raised in donkey using sheep IgG whole molecule as the immunogen.</p>Purity:Min. 95%GPR89A antibody
<p>GPR89A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Rabbit anti Rat IgG (FITC)
<p>Rabbit anti-rat IgG (FITC) was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%Goat anti Bovine IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy chains on bovine IgG and light chains on all bovine immunoglobulins.</p>Purity:Min. 95%Androgen Receptor antibody
<p>The Androgen Receptor antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the androgen receptor, a protein involved in regulating gene expression and cellular growth. This antibody has been shown to be highly effective in detecting and quantifying the levels of the androgen receptor in various tissues, including liver microsomes.</p>Purity:Min. 95%GDF3 antibody
<p>GDF3 antibody was raised in rabbit using highly pure recombinant human GDF-3 as the immunogen.</p>Purity:Min. 95%ZHX2 antibody
<p>ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen</p>Purity:Min. 95%Goat anti Mouse IgM (Fab'2) (HRP)
<p>Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.</p>Purity:Min. 95%Florfenicol Amine antibody
<p>Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>Purity:Min. 95%Factor XIII Subunit A antibody
<p>Factor XIII Subunit A antibody was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.</p>Purity:Min. 95%Goat anti Human IgG (Fab'2) (HRP)
<p>Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.</p>Purity:Min. 95%Monensin antibody
<p>The Monensin antibody is a highly specialized antibody used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets and binds to Monensin, a compound known for its cytotoxic and inhibitory effects on various cellular processes. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting Monensin in biological samples.</p>Purity:Min. 95%CDH23 antibody
<p>CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI</p>Purity:Min. 95%p100 Nuclear Coactivator Protein antibody
<p>p100 Nuclear Coactivator Protein antibody was raised in Guinea Pig using synthetic duplicated C-terminus of human p100 protein conjugated to KLH as the immunogen.</p>Purity:Min. 95%ZNF683 antibody
<p>ZNF683 antibody was raised in rabbit using the N terminal of ZNF683 as the immunogen</p>Purity:Min. 95%Sideroflexin 4 antibody
<p>Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV</p>Purity:Min. 95%Donkey anti Goat IgG
<p>Donkey anti-goat IgG was raised in donkey using goat IgG (H & L) as the immunogen.</p>Purity:Min. 95%eIF4G antibody
<p>The eIF4G antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It specifically targets eIF4G, a key protein involved in the regulation of translation initiation. This antibody has been extensively validated and shown to have high specificity and sensitivity in detecting eIF4G in different samples.</p>Purity:Min. 95%Cotinine antibody
<p>The Cotinine antibody is a monoclonal antibody that specifically binds to cotinine, a metabolite of nicotine. It is commonly used in Life Sciences research to detect and measure cotinine levels in various samples, such as human serum or urine. The antibody can be used in different applications, including ELISA, Western blotting, and immunohistochemistry.</p>Purity:Min. 95%P2RY8 antibody
<p>P2RY8 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%MDM2 antibody
<p>The MDM2 antibody is a powerful tool used in life sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody targets MDM2, a protein that plays a crucial role in regulating cell growth and division.</p>Purity:Min. 95%TIP47 antibody
<p>TIP47 antibody was raised in Guinea Pig using synthetic peptide of murine TIP47 N-terminus as the immunogen.</p>Purity:Min. 95%IKB α antibody
<p>The IKB alpha antibody is a polyclonal antibody used in Life Sciences for various applications. It is designed to target the epidermal growth factor and has been widely used in research studies. This antibody can be used to detect autoantibodies and glucan synthase in pharmaceutical preparations. With its high specificity and sensitivity, it is an essential tool for studying cell antibodies and low-molecular-weight chimeric proteins. The IKB alpha antibody is available as a monoclonal antibody, making it an ideal choice for researchers looking for a reliable medicament. Its ability to target growth factors and localize to the apical membrane makes it suitable for a wide range of experiments. Trust the IKB alpha antibody to deliver accurate and reproducible results in your research endeavors.</p>Purity:Min. 95%Goat anti Human IgG Fc
<p>Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.</p>PDK1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>Purity:Min. 95%Goat anti mouse IgG1
<p>Mouse IgG1 antibody was raised in goat using mouse IgG1 in freunds adjuvant as the immunogen.</p>Purity:Min. 95%Donkey anti Mouse IgG (H + L) (Alk Phos)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%Rabbit anti Chicken IgG (biotin)
<p>Rabbit anti-chicken IgG (biotin) was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%GSG1 antibody
<p>GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE</p>Purity:Min. 95%CD49b antibody
<p>CD49B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Akt antibody
<p>Akt, or Protein Kinase B (PKB), is a key cellular protein that regulates critical processes like growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones such as insulin. Upon activation, Akt moves to the cell membrane, where it becomes fully activated through phosphorylation by kinases like PDK1, enabling it to inhibit apoptosis, support cell growth through pathways like mTOR, and enhance glucose metabolism, vital for insulin response. Dysregulation of the Akt pathway is commonly linked to diseases such as cancer and diabetes, where mutations in components like PI3K, PTEN, or Akt itself can lead to increased cell survival, uncontrolled growth, and treatment resistance in cancer, and reduced glucose uptake in diabetes. Due to its central role in these processes, Akt is a significant focus in therapeutic research targeting growth and metabolic regulation.Akt antibodies are useful for research into cancer and diabetes.</p>Purity:Min. 95%LRRC33 antibody
<p>LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL</p>Purity:Min. 95%p70S6 Kinase antibody
<p>The p70S6 Kinase antibody is a highly effective monoclonal antibody that is used in various assays to detect and measure the activation of p70S6 kinase. It has been extensively tested and validated using human serum samples. This antibody specifically targets the activated form of p70S6 kinase, making it an essential tool for researchers studying cell signaling pathways and protein synthesis.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG.</p>Purity:Min. 95%Capping Protein α 3 antibody
<p>Capping Protein alpha 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of mouse F-actin alpha 3 subunit coupled to KLH as the immunogen.</p>Purity:Min. 95%Zolpidem antibody
<p>Zolpidem antibody is a polyclonal antibody that specifically recognizes zolpidem, a sedative-hypnotic drug used for the treatment of insomnia. The antibody binds to the molecular structure of zolpidem and can be used in immunoassays to detect and quantify the presence of this drug. It is commonly used in life sciences research and pharmaceutical development to study the pharmacokinetics and pharmacodynamics of zolpidem. This antibody is an essential tool for researchers working in the field of drug discovery and development.</p>Purity:Min. 95%DRD1 antibody
<p>DRD1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%MEF2A antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its efficacy through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>Purity:Min. 95%SERPINH1 antibody
<p>SERPINH1 antibody was raised in rabbit using the C terminal of SERPINH1 as the immunogen</p>Purity:Min. 95%STAT6 antibody
<p>The STAT6 antibody is a highly specific and activated protein that plays a crucial role in various biological processes. It is an antigen that can be used for research purposes to detect and analyze the expression of STAT6 in different tissues and cell types. This human monoclonal antibody is designed to target and bind specifically to the STAT6 protein, allowing researchers to study its function and regulation.</p>Purity:Min. 95%BAD antibody
<p>The BAD antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the BAD protein, which plays a crucial role in cell survival and apoptosis regulation. The BAD antibody can be used to study various cellular processes, including insulin signaling, anti-VEGF therapy, and fibrinogen metabolism. This cytotoxic monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>Purity:Min. 95%Pyk2 antibody
<p>The Pyk2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the tyrosine kinase protein known as Pyk2. This antibody is commonly used in various research applications, including the study of progesterone signaling pathways, neuronal activity, and dopamine release.</p>Purity:Min. 95%Goat anti Human IgM (Fab'2) (Texas Red)
<p>Goat anti-human IgM (Fab'2) was raised in goat using human IgM Fc5mu fragment as the immunogen.</p>Purity:Min. 95%Rabbit anti Cat IgG (Alk Phos)
<p>Rabbit anti-cat IgG (Alk Phos) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%BRCA1 antibody
<p>The BRCA1 antibody is a cytotoxic monoclonal antibody that specifically targets and binds to the BRCA1 antigen. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. It has been found to be effective in neutralizing the activity of BRCA1, which is involved in DNA repair and maintenance of genomic stability.</p>Purity:Min. 95%Rabbit anti Rat IgG
<p>Rabbit anti-rat IgG was raised in rabbit using rat IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%PrP 27-30 antibody
<p>PrP 27-30 antibody was raised in goat using a peptide; GQGGGTHSQWNKPSKPKTN, as the immunogen.</p>Purity:Min. 95%Chicken anti Rabbit IgG (H + L)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L) (HRP)
<p>Goat anti-Rabbit IgG (H + L) (HRP) was raised in goat using purified Rabbit IgG (H&L) as the immunogen.</p>Purity:Min. 95%Goat anti Mouse IgG (H + L) (HRP)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%Rabbit anti Goat IgG Fc (HRP)
<p>This antibody reacts with heavy chains on Goat IgG.</p>Purity:Min. 95%α 1 Antiplasmin antibody
<p>alpha 1 Antiplasmin antibody was raised in goat using human alpha 1 Antiplasmin purified from plasma as the immunogen.</p>Purity:Min. 95%HIV1 protease antibody
<p>HIV1 protease antibody was raised in rabbit using full length recombinant protease (HIV-1) as the immunogen.</p>Purity:Min. 95%Pygm antibody
<p>Pygm antibody was raised in rabbit using the C terminal of Pygm as the immunogen</p>Purity:Min. 95%Goat anti Chicken IgG (H + L) (biotin)
<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>Purity:Min. 95%Galectin 3 antibody
<p>Galectin 3 antibody is a highly specialized antibody that specifically targets and binds to galectin-3, a protein involved in various biological processes. This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for galectin-3. It can be used in a wide range of applications in the field of life sciences.</p>Purity:Min. 95%Rabbit anti Goat IgG Fc (rhodamine)
<p>This antibody reacts with heavy chains on Goat IgG.</p>Purity:Min. 95%IL1RL1 antibody
<p>The IL1RL1 antibody is a medicament that belongs to the class of polyclonal and monoclonal antibodies. It is cytotoxic and specifically targets the TNF-related apoptosis-inducing ligand (TRAIL) receptor 1 (IL1RL1). This antibody can be used for therapeutic purposes in various diseases where TRAIL signaling is involved, such as cancer. The IL1RL1 antibody binds to IL1RL1 on the surface of cells and induces cell death by activating apoptotic pathways. It has been shown to inhibit the growth and proliferation of cells expressing IL1RL1, making it a potential treatment option for certain types of cancer. Additionally, this antibody has been used in research studies to investigate the role of IL1RL1 in various biological processes.</p>Purity:Min. 95%Carbadox antibody
<p>Carbadox antibody is a potent antigen that is used in immunoassay methods for the detection and quantification of carbadox. It is produced by hybridoma cell strains that have been generated by immunizing animals with carbadox conjugated to succinic anhydride. The resulting antibodies are specific to carbadox and can be used in both polyclonal and monoclonal antibody-based immunoassays. These antibodies bind to the carboxyl, hydroxyl, and methylamino groups of carbadox, allowing for highly sensitive and specific detection. Carbadox antibody has a wide range of applications in various industries, including food safety testing, pharmaceutical research, and environmental monitoring. With its high affinity and specificity, this antibody is an invaluable tool for accurate and reliable detection of carbadox residues.</p>Purity:Min. 95%Hepatitis C Virus antibody
<p>HCV antibody was raised in rabbit using residues 33-43 [CGVYLLPRRGPR] of HCV core, env, and part of E2/NS1 of HCV as the immunogen.</p>Purity:Min. 95%DLK1 antibody
<p>The DLK1 antibody is a highly specific polyclonal antibody that binds to the antigen binding domain of the CB2 receptor. It is used in life sciences research to detect and study cell antigens and human enzymes. This antibody is produced using advanced techniques and has been validated for its high specificity and sensitivity. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. The DLK1 antibody is an essential tool for researchers working with biomolecules and studying specific antibodies. Its high affinity and specificity make it ideal for detecting and quantifying target proteins in biological samples. With its ability to bind to actin filaments, this antibody can provide valuable insights into cellular processes and signaling pathways.</p>Purity:Min. 95%SCGF β antibody
<p>SCGF beta antibody was raised in goat using highly pure recombinant human SCGF-beta as the immunogen.</p>Purity:Min. 95%Goat anti Rabbit IgG (Fab'2) (FITC)
<p>Goat anti-rabbit IgG (Fab'2) (FITC) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>Purity:Min. 95%RAB3D antibody
<p>RAB3D antibody was raised in rabbit using the C terminal of RAB3D as the immunogen</p>Purity:Min. 95%FGFR4 antibody
<p>The FGFR4 antibody is a highly specialized chemotherapy agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is known for its toxic effects on targeted cells. This antibody specifically targets growth factor receptors, inhibiting their activity and preventing cell proliferation. It can be used as a monoclonal antibody or in combination with other inhibitors or sequestrants to enhance its therapeutic effects. The FGFR4 antibody has been extensively studied as a test substance in various research studies, demonstrating its efficacy in blocking the extracellular signaling pathways involved in cell growth and development. Its unique ability to bind to specific polynucleotides makes it an excellent inhibitor for targeted therapy.</p>Purity:Min. 95%HSP27 antibody
<p>The HSP27 antibody is a monoclonal antibody that targets the heat shock protein 27 (HSP27). HSP27 is a growth factor that plays a crucial role in various cellular processes, including cell survival, differentiation, and apoptosis. This antibody specifically binds to HSP27 and can be used for research purposes in the Life Sciences field.</p>Purity:Min. 95%c-Kit antibody
<p>The c-Kit antibody is a highly specialized product used in the field of Life Sciences. This antibody targets the c-Kit protein, which plays a crucial role in cell growth and differentiation. By binding to c-Kit, this antibody can effectively inhibit the activity of this protein, making it an essential tool for researchers studying various cellular processes.</p>Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Goat anti Human IgE (ε chain)
<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>Purity:Min. 95%Goat anti Monkey IgG + IgA + IgM (H + L) (rhodamine)
<p>Goat anti-monkey IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using monkey IgG, IgA, IgM whole molecules as the immunogen.</p>Purity:Min. 95%Goat anti Rat IgG (Fab'2) (rhodamine)
<p>Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%Phencyclidine antibody
<p>Phencyclidine antibody is a specific antibody that is produced by hybridoma cells. It is commonly used in life sciences research to detect and measure the presence of phencyclidine (PCP) in various samples. The antibody can be used in different immunoassay techniques, such as enzyme-linked immunosorbent assay (ELISA) or Western blotting, to accurately quantify PCP levels. Additionally, this antibody can also be used for electrochemical impedance spectroscopy on a reactive carbon electrode to provide real-time monitoring of PCP concentration. Overall, the Phencyclidine antibody is a valuable tool for researchers working with PCP detection and analysis.</p>Purity:Min. 95%EGFR antibody
<p>The EGFR antibody is a highly specialized product in the field of Life Sciences. It is a histidine-rich family kinase inhibitor that specifically targets the epidermal growth factor receptor (EGFR). This antibody plays a crucial role in various biological processes, such as cell proliferation and differentiation. By binding to EGFR, it prevents the activation of downstream signaling pathways, ultimately inhibiting the growth and survival of cancer cells.</p>Purity:Min. 95%MLLT4 antibody
<p>MLLT4 antibody was raised in rabbit using the N terminal of MLLT4 as the immunogen</p>Purity:Min. 95%C3orf31 antibody
<p>C3orf31 antibody was raised in rabbit using the N terminal of C3ORF31 as the immunogen</p>Purity:Min. 95%Adipophilin antibody
<p>Adipophilin antibody was raised in guinea pig using a synthetic peptide corresponding to residues 1-29 of the N-terminus of human and murine adipophilin as the immunogen.</p>HIV1 gp120 antibody
<p>HIV1 gp120 antibody was raised in rabbit using HIV-1 gp120 as the immunogen.</p>Purity:Min. 95%Fractin antibody
<p>The Fractin antibody is a highly specialized monoclonal antibody that has neutralizing properties against androgen. It acts as an inhibitor of cytotoxic growth factors by binding to specific proteins, such as glycoproteins and chemokines. This antibody is commonly used in research settings to study the effects of these growth factors on various cell types.</p>Purity:Min. 95%Keratin K25 antibody
<p>Keratin K25 antibody was raised in Guinea Pig using synthetic peptide of human keratin K25 coupled to KLH as the immunogen.</p>Purity:Min. 95%PLCG2 antibody
<p>The PLCG2 antibody is a highly specialized antibody that targets the PLCG2 protein. This protein plays a crucial role in various cellular processes, including signal transduction and immune response. The antibody specifically recognizes and binds to the activated form of PLCG2, inhibiting its activity and preventing further downstream signaling.</p>Purity:Min. 95%CXCL16 antibody
<p>CXCL16 antibody was raised in goat using highly pure recombinant murine CXCL16 as the immunogen.</p>Purity:Min. 95%Donkey anti Sheep IgG (H + L) (Alk Phos)
<p>Donkey anti-Sheep IgG (H + L) (Alk Phos) was raised in donkey using purified Sheep IgG (H&L) as the immunogen.</p>Purity:Min. 95%MTFMT antibody
<p>MTFMT antibody was raised in rabbit using the C terminal of MTFMT as the immunogen</p>Purity:Min. 95%Goat anti Mouse IgM (mu chain) (FITC)
<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a monoclonal antibody that specifically targets and binds to tau protein, which is involved in the formation of neurofibrillary tangles in the brain. This antibody has cytotoxic properties, meaning it can induce cell death in cells that express high levels of tau protein. The Tau antibody has been extensively studied in the field of Life Sciences and has shown promising results in the treatment of neurodegenerative diseases such as Alzheimer's disease. It has also been used in research to study the role of tau protein in other conditions, including Parkinson's disease and certain types of cancer. The Tau antibody is a valuable tool for scientists and researchers working in the field of neuroscience and protein biology.</p>Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
<p>Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>Purity:Min. 95%ANGPTL3 antibody
<p>ANGPTL3 antibody was raised in rabbit using the N terminal of ANGPTL3 as the immunogen</p>Purity:Min. 95%UNCX antibody
<p>UNCX antibody was raised in rabbit using the C terminal of UNCX as the immunogen</p>Purity:Min. 95%GIMAP1 antibody
<p>GIMAP1 antibody was raised using the N terminal of GIMAP1 corresponding to a region with amino acids MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ</p>Purity:Min. 95%AHSG antibody
<p>AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL</p>Purity:Min. 95%LYVE1 antibody
<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>Purity:Min. 95%ATF2 antibody
<p>The ATF2 antibody is a highly specialized monoclonal antibody that targets the alpha-fetoprotein (AFP) and amyloid protein. It is activated by a DNA vaccine and has been extensively tested in human serum samples. This antibody specifically binds to ATF2, a transcription factor that plays a critical role in cell survival and proliferation. The ATF2 antibody can be used for ultrasensitive detection of AFP and amyloid protein in various bioassays. Its high specificity and sensitivity make it an ideal tool for researchers studying the role of these proteins in disease development and progression. Additionally, this antibody can be used in phosphatase-linked immunoassays or carbon electrode-based assays for genotoxicity testing. With its versatile applications, the ATF2 antibody is a valuable asset for any laboratory conducting research in these fields.</p>SYK antibody
<p>The SYK antibody is a highly effective polyclonal antibody that is used for various applications. It can be used in research and diagnostic settings to detect and measure the presence of specific proteins or biomarkers. The SYK antibody works by binding to its target protein, sclerostin, which plays a crucial role in bone metabolism. By targeting sclerostin, the SYK antibody helps to inhibit its function and promote bone formation.</p>ZNF699 antibody
<p>ZNF699 antibody was raised in rabbit using the N terminal of ZNF699 as the immunogen</p>Purity:Min. 95%FAM50B antibody
<p>FAM50B antibody was raised using the N terminal of FAM50B corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD</p>SAMHD1 antibody
<p>The SAMHD1 antibody is a highly specialized monoclonal antibody that specifically targets the SAMHD1 protein. This protein plays a crucial role in regulating the cellular dNTP pool, which is essential for DNA replication and repair. By binding to SAMHD1, this antibody can effectively inhibit its function and disrupt the normal cell cycle.</p>DCK antibody
<p>The DCK antibody is a monoclonal antibody that is activated and functions as a globulin. It possesses antiviral properties and acts as a natriuretic agent. This antibody is widely used in the field of Life Sciences for various applications, including neutralizing specific targets and serving as a family kinase inhibitor. Additionally, it has been found to have immobilization properties when used in conjunction with excipients. The DCK antibody can be utilized in research settings, such as in vitro studies involving human serum or electrode-based experiments. Its versatility makes it an essential tool for scientists and researchers in various fields.</p>CD11b antibody (Azide Free)
<p>CD11b antibody (Azide Free) was raised in rat using C57BL/10 murine splenic T cells and concanavalin A-activated C57BL/10 splenocytes as the immunogen.</p>Purity:Min. 95%CD86 antibody (Allophycocyanin)
<p>CD86 antibody (Allophycocyanin) was raised in rat using LPS-activated murine B cells as the immunogen.</p>Purity:Min. 95%KLRG1 antibody (FITC)
<p>KLRG1 antibody (FITC) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.</p>Purity:Min. 95%CD81 antibody (FITC)
<p>CD81 antibody (FITC) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.</p>Purity:Min. 95%CD3e antibody (CY5)
<p>CD3e antibody (CY5) was raised in rat using CD3e as the immunogen.</p>Purity:Min. 95%ATP2C1 antibody
<p>ATP2C1 antibody was raised using the C terminal of ATP2C1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA</p>Purity:Min. 95%CD8b antibody (FITC)
<p>CD8b antibody (FITC) was raised in Mouse using the beta chain of chicken CD8 as the immunogen.</p>Purity:Min. 95%CD23 antibody (PE-CY7)
<p>CD23 antibody (PE) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>Purity:Min. 95%CD105 antibody (FITC)
<p>CD105 antibody (FITC) was raised in mouse using membrane preparation of human B-lineage leukemia cells as the immunogen.</p>Purity:Min. 95%HRG1 β antibody
<p>HRG1 beta antibody was raised in rabbit using highly pure recombinant human heregulin-beta1 as the immunogen.</p>Purity:Min. 95%Streptococcus Group A antibody (HRP)
<p>Streptococcus group A antibody (FITC) was raised in goat using group A Streptococci as the immunogen.</p>Purity:Min. 95%CD66acde antibody
<p>CD66acde antibody was raised in mouse using human granulocytes as the immunogen.</p>Purity:Min. 95%CD154 antibody (PE)
<p>CD154 antibody (PE) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.</p>Purity:Min. 95%CD106 antibody (Azide Free)
<p>CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.</p>Purity:Min. 95%CD45 antibody (FITC)
<p>CD45 antibody (FITC) was raised in mouse using chicken CD45 as the immunogen.</p>Purity:Min. 95%CD117 antibody (Spectral Red)
<p>CD117 antibody (FITC) was raised in rat using murine CD117/c-Kit as the immunogen.</p>Purity:Min. 95%CD18 antibody (biotin)
<p>CD18 antibody (biotin) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.</p>Purity:Min. 95%CD8a antibody (biotin)
<p>CD8a antibody (biotin) was raised in mouse using the alpha chain of chicken CD8a as the immunogen.</p>Purity:Min. 95%
