Primary Antibodies

<p>The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.</p>

<p>LPIN2 antibody was raised in rabbit using the C terminal of LPIN2 as the immunogen</p>

<p>DNASE2 antibody was raised in Rabbit using Human DNASE2 as the immunogen</p>

<p>FBXO22 antibody was raised using the middle region of FBXO22 corresponding to a region with amino acids CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE</p>

<p>GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids  GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV</p>

<p>ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ</p>

<p>The MTHFR antibody is a glycosylated glycopeptide that belongs to the class of chemokines. It is used in the field of Life Sciences for various applications, including the detection and quantification of interferon-gamma (IFN-γ) in biological samples. This antibody specifically targets the nuclear protein MTHFR and can be used in experiments such as immunofluorescence and Western blotting. Additionally, it has been shown to have inhibitory effects on factors such as alpha-fetoprotein and β-catenin, making it a valuable tool for studying signal transduction pathways. With its high specificity and affinity, the MTHFR antibody is an essential component for researchers working in the field of molecular biology and cellular signaling.</p>

<p>KLRC1 antibody was raised in rabbit using the C terminal of KLRC1 as the immunogen</p>

<p>MYO1B antibody was raised in Rabbit using Human MYO1B as the immunogen</p>

<p>GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT</p>

<p>Rabbit polyclonal NGAL antibody (HRP)</p>

<p>The RB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the histidine receptor, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in blocking the actions of histidine, thereby modulating its effects on cellular signaling pathways.</p>

<p>ERBB3 antibody was raised in Rabbit using Human ERBB3 as the immunogen</p>

<p>Rabbit Polyclonal IGF1R antibody (Tyr1165/Tyr1166)</p>

<p>Rabbit polyclonal ATRIP antibody (Ser224)</p>

<p>PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE</p>

<p>FBP1 antibody was raised in Rabbit using Human FBP1 as the immunogen</p>

<p>ARFGAP3 antibody was raised in Rabbit using Human ARFGAP3 as the immunogen</p>

<p>GOT2 antibody was raised in Mouse using a purified recombinant fragment of human GOT2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal POLR2D antibody</p>

<p>FAF1 antibody was raised in Rabbit using Human FAF1 as the immunogen</p>

<p>LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ</p>

<p>The BRCA1 antibody is a highly specialized monoclonal antibody that specifically targets the BRCA1 protein. This protein plays a crucial role in DNA repair and is associated with the development of breast and ovarian cancers. The BRCA1 antibody has been extensively studied and has shown cytotoxic effects on cancer cells by inhibiting the activity of protein kinases involved in cell proliferation. It binds to the nuclear compartment of cells, specifically targeting the BRCA1 protein, which leads to its degradation and prevents its function in repairing damaged DNA. This antibody has also been used in research to study other proteins, such as alpha-synuclein and collagen, and has shown potential as a therapeutic agent for various types of cancer. With its high specificity and ability to inhibit activated proteins, the BRCA1 antibody is a valuable tool for both diagnostic purposes and targeted therapies.</p>

<p>Rabbit polyclonal ARRDC3 antibody</p>

<p>Rabbit polyclonal CHRM5 antibody</p>

<p>Rabbit polyclonal Elk1 antibody (Ser383)</p>

<p>Rabbit polyclonal MAPKAPK2 antibody</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG</p>

<p>SAP30BP antibody was raised in rabbit using the N terminal of SAP30BP as the immunogen</p>

<p>ABCD2 antibody was raised in rabbit using the N terminal of ABCD2 as the immunogen</p>

<p>NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ</p>

<p>Rabbit polyclonal GFAP antibody (Prediluted for IHC)</p>

<p>SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ</p>

<p>IL20 antibody was raised in goat using highly pure recombinant human IL-20 as the immunogen.</p>

<p>CD22 antibody was raised in rabbit using the N terminal of CD22 as the immunogen</p>

<p>Purified Polyclonal AHRL antibody</p>

<p>ST6GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL</p>

<p>Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL</p>

<p>Purified Polyclonal CAMK2A antibody</p>

<p>C1QA antibody was raised in rabbit using the N terminal of C1QA as the immunogen</p>

<p>NT3 antibody was raised in rabbit using highly pure recombinant human NT-3 as the immunogen.</p>

<p>Pcnp antibody was raised in rabbit using the C terminal of Pcnp as the immunogen</p>

<p>AAV5 antibody was raised in rabbit using residues 530-541 [NSQPANPGTTATC] of 80 kDa capsid VP3 protein of AAV 5 as the immunogen.</p>

<p>BRD4 antibody was raised in rabbit using the C terminal of BRD4 as the immunogen</p>

<p>Dag1 antibody was raised in rabbit using the C terminal of Dag1 as the immunogen</p>

<p>Notch 2 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 2 (NOTCH2) protein as the immunogen.</p>

<p>DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP</p>

<p>Purified Polyclonal CDKL2 antibody</p>

<p>CASP1 antibody was raised in rabbit using the middle region of CASP1 as the immunogen</p>

<p>LYSMD4 antibody was raised using the N terminal of LYSMD4 corresponding to a region with amino acids PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD</p>

<p>Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW</p>

<p>PIBF1 antibody was raised in rabbit using the C terminal of PIBF1 as the immunogen</p>

<p>ZNF606 antibody was raised in rabbit using the N terminal of ZNF606 as the immunogen</p>

<p>VEZF1 antibody was raised in rabbit using the middle region of VEZF1 as the immunogen</p>

<p>GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ</p>

<p>Apbb1 antibody was raised in rabbit using the N terminal of Apbb1 as the immunogen</p>

<p>MDC1 antibody was raised in rabbit using the C terminal of MDC1 as the immunogen</p>

<p>Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids  PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS</p>

<p>ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN</p>

<p>RBM18 antibody was raised in rabbit using the middle region of RBM18 as the immunogen</p>

<p>Tmed1 antibody was raised in rabbit using the N terminal of Tmed1 as the immunogen</p>

<p>TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL</p>

<p>B3GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC</p>

<p>PDPK1 antibody was raised in rabbit using the middle region of PDPK1 as the immunogen</p>

<p>SLC25A37 antibody was raised in rabbit using the middle region of SLC25A37 as the immunogen</p>

<p>UBA5 antibody was raised using the middle region of UBA5 corresponding to a region with amino acids VLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACF</p>

<p>MIER3 antibody was raised in rabbit using the middle region of MIER3 as the immunogen</p>

<p>CD72 antibody was raised in rabbit using residues 25-37 [LGQDPGADDDGEI] of the 42 kDa human CD72 protein as the immunogen.</p>

<p>OPN1SW antibody was raised in rabbit using the C terminal of OPN1SW as the immunogen</p>

<p>TH1L antibody was raised in rabbit using the N terminal of TH1L as the immunogen</p>

<p>TRIP6 antibody was raised in rabbit using the middle region of TRIP6 as the immunogen</p>

<p>DGKQ antibody was raised in rabbit using the middle region of DGKQ as the immunogen</p>

<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE</p>

<p>YAP1 antibody was raised in rabbit using the C terminal of YAP1 as the immunogen</p>

<p>SERPINB6 antibody was raised in rabbit using the middle region of SERPINB6 as the immunogen</p>

<p>LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK</p>

<p>ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV</p>

<p>DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogen</p>

<p>Rabbit polyclonal MPO antibody (Prediluted for IHC)</p>

<p>PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW</p>

<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>

<p>ZNF414 antibody was raised in rabbit using the N terminal of ZNF414 as the immunogen</p>

<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>

<p>SLC39A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA</p>

<p>ZNF404 antibody was raised in rabbit using the middle region of ZNF404 as the immunogen</p>

<p>SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY</p>

<p>ACVR2B antibody was raised using the C terminal of ACVR2B corresponding to a region with amino acids HDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI</p>

<p>PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN</p>

<p>APC2 antibody was raised in rabbit using the middle region of APC2 as the immunogen</p>

<p>PAI1 antibody was raised in rabbit using highly pure recombinant human PAI-1 as the immunogen.</p>

<p>KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA</p>

<p>REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE</p>

<p>ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogen</p>

<p>LRRFIP2 antibody was raised in rabbit using the N terminal of LRRFIP2 as the immunogen</p>

<p>RAB9A antibody was raised in rabbit using the middle region of RAB9A as the immunogen</p>

<p>SGPP1 antibody was raised in rabbit using the middle region of SGPP1 as the immunogen</p>

<p>BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE</p>

<p>Rabbit polyclonal Desmin antibody (Prediluted for IHC)</p>

<p>ELMO1 antibody was raised in rabbit using the C terminal of ELMO1 as the immunogen</p>

<p>GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA</p>

<p>ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY</p>

<p>SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA</p>

<p>Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND</p>

<p>TAF9 antibody was raised in rabbit using the N terminal of TAF9 as the immunogen</p>

<p>PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS</p>

<p>DNAJC19 antibody was raised in rabbit using the C terminal of DNAJC19 as the immunogen</p>

<p>Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP</p>

<p>ZHX3 antibody was raised in rabbit using the middle region of ZHX3 as the immunogen</p>

<p>OPRL1 antibody was raised in rabbit using the middle region of OPRL1 as the immunogen</p>

<p>MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE</p>

<p>POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC</p>

<p>Wdr8 antibody was raised in rabbit using the N terminal of Wdr8 as the immunogen</p>

<p>GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY</p>

<p>SIN3B antibody was raised in rabbit using the middle region of SIN3B as the immunogen</p>

<p>Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM</p>

<p>TRAFD1 antibody was raised in rabbit using the C terminal of TRAFD1 as the immunogen</p>

<p>ZHX3 antibody was raised in rabbit using the middle region of ZHX3 as the immunogen</p>

<p>CTGFL antibody was raised in rabbit using highly pure recombinant human CTGFL/WISP-2 as the immunogen.</p>

<p>OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA</p>

<p>Purified Polyclonal NKX2.6 antibody</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>LCOR antibody was raised in rabbit using the C terminal of LCOR as the immunogen</p>

<p>Purified Polyclonal BTF3L4 antibody</p>

<p>RASSF1 antibody was raised in rabbit using the C terminal of RASSF1 as the immunogen</p>

<p>KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG</p>

<p>KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids YRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFL</p>

<p>MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogen</p>

<p>The AQP3 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets nucleotide molecules and has shown high affinity for the anti-HER2 antibody trastuzumab. This antibody plays a crucial role in research and diagnostics by detecting and quantifying the presence of specific proteins or antigens.</p>

<p>FAM14A antibody was raised using the middle region of FAM14A corresponding to a region with amino acids LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPK</p>

<p>Ppp2r2c antibody was raised in rabbit using the N terminal of Ppp2r2c as the immunogen</p>

<p>Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA</p>

<p>SENP6 antibody was raised in rabbit using the C terminal of SENP6 as the immunogen</p>

<p>JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ</p>

<p>The TGFBR2 antibody is a polyclonal antibody that specifically targets the growth factor receptor known as TGFBR2. This antibody has been extensively studied and has shown promising results in various applications. It has been used in combination with other antibodies, such as trastuzumab, to enhance the cytotoxic effects against cancer cells. Additionally, the TGFBR2 antibody has been used to detect and quantify specific antibodies, including anti-ACTH antibodies, in various samples. It has also been utilized in research studies involving mycoplasma genitalium and collagen inhibitors. The TGFBR2 antibody is a valuable tool for researchers studying EGF-like growth factors, TGF-beta signaling pathways, chemokines, and other related areas of study. With its high specificity and neutralizing capabilities, this monoclonal antibody is an essential asset for any researcher in need of reliable and accurate results.</p>

<p>ZNF285A antibody was raised in rabbit using the middle region of ZNF285A as the immunogen</p>

<p>ZNF765 antibody was raised in rabbit using the middle region of ZNF765 as the immunogen</p>

<p>Purified Polyclonal BCLW antibody</p>

<p>NT4 antibody was raised in goat using highly pure recombinant human NT-4 as the immunogen.</p>

<p>FAM13C1 antibody was raised in rabbit using the N terminal of FAM13C1 as the immunogen</p>

<p>Rabbit polyclonal P38 MAPK antibody (Thr179)</p>

<p>Goat anti-cat IgM mu chain was raised in goat using highly pure cat IgM in Freund's adjuvant as the immunogen.</p>

<p>Rabbit polyclonal CEB alpha antibody (Ser21)</p>

<p>The EGFR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), a protein that plays a crucial role in cell growth and division. This antibody can be used in various applications, such as chemiluminescent immunoassays, where it enables the detection and quantification of EGFR levels in samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Goat anti-rabbit IgG (biotin) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>The Tau antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to specifically target and bind to tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's. The antibody is conjugated with low-density microspheres, allowing for easy detection and analysis.</p>

<p>ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen</p>

<p>Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.</p>

<p>Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>Factor XIII Subunit A antibody was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.</p>

<p>Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.</p>

<p>The Monensin antibody is a highly specialized antibody used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets and binds to Monensin, a compound known for its cytotoxic and inhibitory effects on various cellular processes. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting Monensin in biological samples.</p>

<p>p100 Nuclear Coactivator Protein antibody was raised in Guinea Pig using synthetic duplicated C-terminus of human p100 protein conjugated to KLH as the immunogen.</p>

<p>ZNF683 antibody was raised in rabbit using the N terminal of ZNF683 as the immunogen</p>

<p>Donkey anti-goat IgG was raised in donkey using goat IgG (H &amp; L) as the immunogen.</p>

<p>The eIF4G antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It specifically targets eIF4G, a key protein involved in the regulation of translation initiation. This antibody has been extensively validated and shown to have high specificity and sensitivity in detecting eIF4G in different samples.</p>

<p>The Cotinine antibody is a monoclonal antibody that specifically binds to cotinine, a metabolite of nicotine. It is commonly used in Life Sciences research to detect and measure cotinine levels in various samples, such as human serum or urine. The antibody can be used in different applications, including ELISA, Western blotting, and immunohistochemistry.</p>

<p>P2RY8 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The MDM2 antibody is a powerful tool used in life sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody targets MDM2, a protein that plays a crucial role in regulating cell growth and division.</p>

<p>TIP47 antibody was raised in Guinea Pig using synthetic peptide of murine TIP47 N-terminus as the immunogen.</p>

<p>The IKB alpha antibody is a polyclonal antibody used in Life Sciences for various applications. It is designed to target the epidermal growth factor and has been widely used in research studies. This antibody can be used to detect autoantibodies and glucan synthase in pharmaceutical preparations. With its high specificity and sensitivity, it is an essential tool for studying cell antibodies and low-molecular-weight chimeric proteins. The IKB alpha antibody is available as a monoclonal antibody, making it an ideal choice for researchers looking for a reliable medicament. Its ability to target growth factors and localize to the apical membrane makes it suitable for a wide range of experiments. Trust the IKB alpha antibody to deliver accurate and reproducible results in your research endeavors.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Mouse IgG1 antibody was raised in goat using mouse IgG1 in freunds adjuvant as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Rabbit anti-chicken IgG (biotin) was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.</p>

<p>CD49B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Akt, or Protein Kinase B (PKB), is a key cellular protein that regulates critical processes like growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones such as insulin. Upon activation, Akt moves to the cell membrane, where it becomes fully activated through phosphorylation by kinases like PDK1, enabling it to inhibit apoptosis, support cell growth through pathways like mTOR, and enhance glucose metabolism, vital for insulin response. Dysregulation of the Akt pathway is commonly linked to diseases such as cancer and diabetes, where mutations in components like PI3K, PTEN, or Akt itself can lead to increased cell survival, uncontrolled growth, and treatment resistance in cancer, and reduced glucose uptake in diabetes. Due to its central role in these processes, Akt is a significant focus in therapeutic research targeting growth and metabolic regulation.Akt antibodies are useful for research into cancer and diabetes.</p>

<p>The p70S6 Kinase antibody is a highly effective monoclonal antibody that is used in various assays to detect and measure the activation of p70S6 kinase. It has been extensively tested and validated using human serum samples. This antibody specifically targets the activated form of p70S6 kinase, making it an essential tool for researchers studying cell signaling pathways and protein synthesis.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG.</p>

<p>Capping Protein alpha 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of mouse F-actin alpha 3 subunit coupled to KLH as the immunogen.</p>

<p>Zolpidem antibody is a polyclonal antibody that specifically recognizes zolpidem, a sedative-hypnotic drug used for the treatment of insomnia. The antibody binds to the molecular structure of zolpidem and can be used in immunoassays to detect and quantify the presence of this drug. It is commonly used in life sciences research and pharmaceutical development to study the pharmacokinetics and pharmacodynamics of zolpidem. This antibody is an essential tool for researchers working in the field of drug discovery and development.</p>

<p>DRD1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its efficacy through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>SERPINH1 antibody was raised in rabbit using the C terminal of SERPINH1 as the immunogen</p>

<p>The STAT6 antibody is a highly specific and activated protein that plays a crucial role in various biological processes. It is an antigen that can be used for research purposes to detect and analyze the expression of STAT6 in different tissues and cell types. This human monoclonal antibody is designed to target and bind specifically to the STAT6 protein, allowing researchers to study its function and regulation.</p>