Primary Antibodies

<p>ZNF572 antibody was raised in rabbit using the middle region of ZNF572 as the immunogen</p>

<p>SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV</p>

<p>MFSD8 antibody was raised in rabbit using the middle region of MFSD8 as the immunogen</p>

<p>Beta 2 Microglobulin antibody was raised against Human Beta-2-Microglobulin.</p>

<p>ZNF555 antibody was raised in rabbit using the N terminal of ZNF555 as the immunogen</p>

<p>OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen</p>

<p>LRRC4C antibody was raised using the N terminal of LRRC4C corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE</p>

<p>PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP</p>

<p>ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS</p>

<p>ZSCAN1 antibody was raised in rabbit using the middle region of ZSCAN1 as the immunogen</p>

<p>Rabbit polyclonal S100 Protein antibody (Prediluted for IHC)</p>

<p>SLC34A3 antibody was raised in rabbit using the middle region of SLC34A3 as the immunogen</p>

<p>Please enquire for more information about Goat anti Human IgM (mu Chain) (Alk Phos) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trim3 antibody was raised in rabbit using the N terminal of Trim3 as the immunogen</p>

<p>OSBPL11 antibody was raised in rabbit using the C terminal of OSBPL11 as the immunogen</p>

<p>PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT</p>

<p>OR2M5 antibody was raised in rabbit using the C terminal of OR2M5 as the immunogen</p>

<p>Purified Polyclonal PKC mu antibody</p>

<p>UGT1A5 antibody was raised in rabbit using the N terminal of UGT1A5 as the immunogen</p>

<p>NRIP3 antibody was raised in rabbit using the middle region of NRIP3 as the immunogen</p>

<p>NPFF2 antibody was raised in rabbit using human NPFF2 protein as the immunogen.</p>

<p>LOC391764 antibody was raised in rabbit using the middle region of LOC391764 as the immunogen</p>

<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>

<p>SLCO3A1 antibody was raised using the middle region of SLCO3A1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL</p>

<p>SERPINF2 antibody was raised in rabbit using the N terminal of SERPINF2 as the immunogen</p>

<p>HCN3 antibody was raised using the middle region of HCN3 corresponding to a region with amino acids LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV</p>

<p>DMRTA2 antibody was raised in rabbit using the C terminal of DMRTA2 as the immunogen</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in the field of Life Sciences. It plays a crucial role in various biological processes, including growth factor signaling, phosphatase activity, and binding to nuclear proteins. This monoclonal antibody specifically targets tyrosine hydroxylase, an enzyme involved in the synthesis of important neurotransmitters such as dopamine.</p>

<p>TMEM166 antibody was raised in rabbit using the middle region of TMEM166 as the immunogen</p>

<p>COL4A6 antibody was raised in rabbit using the middle region of COL4A6 as the immunogen</p>

<p>NUDC antibody was raised using a synthetic peptide corresponding to a region with amino acids DAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYR</p>

<p>C14ORF101 antibody was raised in rabbit using the N terminal of C14ORF101 as the immunogen</p>

<p>Ambp antibody was raised in rabbit using the N terminal of Ambp as the immunogen</p>

<p>TNF receptor type I antibody was raised in rabbit using highly pure recombinant human sTNF-receptor as the immunogen.</p>

<p>TMEM38A antibody was raised using the N terminal of TMEM38A corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE</p>

<p>SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV</p>

<p>ZNF131 antibody was raised in rabbit using the N terminal of ZNF131 as the immunogen</p>

<p>TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR</p>

<p>GABRA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR</p>

<p>TRIM34 antibody was raised in rabbit using the N terminal of TRIM34 as the immunogen</p>

<p>RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF</p>

<p>NAT8B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA</p>

<p>FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV</p>

<p>Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR</p>

<p>FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE</p>

<p>SLC9A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids INYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQT</p>

<p>Fbxo32 antibody was raised in rabbit using the C terminal of Fbxo32 as the immunogen</p>

<p>Fibrinogen antibody was raised against Human Fibrinogen.</p>

<p>EMX1 antibody was raised in rabbit using the middle region of EMX1 as the immunogen</p>

<p>VPS41 antibody was raised in rabbit using the middle region of VPS41 as the immunogen</p>

<p>Scg2 antibody was raised in rabbit using the middle region of Scg2 as the immunogen</p>

<p>PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG</p>

<p>MOBKL2A antibody was raised in rabbit using the middle region of MOBKL2A as the immunogen</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.</p>

<p>DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR</p>

<p>TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT</p>

<p>C1QB antibody was raised using the middle region of C1QB corresponding to a region with amino acids PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR</p>

<p>H6PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW</p>

<p>PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS</p>

<p>OR5T2 antibody was raised using the C terminal of OR5T2 corresponding to a region with amino acids  DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK</p>

<p>TARC antibody was raised in rabbit using highly pure recombinant human TARC as the immunogen.</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG</p>

<p>App antibody was raised in rabbit using the C terminal of App as the immunogen</p>

<p>CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV</p>

<p>DIDO1 antibody was raised in rabbit using the N terminal of DIDO1 as the immunogen</p>

<p>AMN antibody was raised in rabbit using the N terminal of AMN as the immunogen</p>

<p>MRPL49 antibody was raised in rabbit using the N terminal of MRPL49 as the immunogen</p>

<p>ERG antibody was raised in rabbit using the N terminal of ERG as the immunogen</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>

<p>ZNF389 antibody was raised in rabbit using the N terminal of ZNF389 as the immunogen</p>

<p>Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE</p>

<p>PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen</p>

<p>FHL3 antibody was raised in rabbit using the middle region of FHL3 as the immunogen</p>

<p>PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV</p>

<p>APOL2 antibody was raised in rabbit using the middle region of APOL2 as the immunogen</p>

<p>F2 antibody was raised in rabbit using the N terminal of F2 as the immunogen</p>

<p>VEGFB antibody was raised in rabbit using the C terminal of VEGFB as the immunogen</p>

<p>TTC17 antibody was raised using the N terminal of TTC17 corresponding to a region with amino acids HNKEDPDCIKAKVPLGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPE</p>

<p>TRAF3IP3 antibody was raised using the C terminal of TRAF3IP3 corresponding to a region with amino acids DLQDQLKRSEAEKLTLVTRVQQLQGLLQNQSLQLQEQEKLLTKKDQALPV</p>

<p>ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK</p>

<p>NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL</p>

<p>UNC45A antibody was raised in rabbit using the N terminal of UNC45A as the immunogen</p>

<p>ZNF417 antibody was raised in rabbit using the N terminal of ZNF417 as the immunogen</p>

<p>Purified Polyclonal ALDOB antibody</p>

<p>EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI</p>

<p>ZNF682 antibody was raised in rabbit using the middle region of ZNF682 as the immunogen</p>

<p>SFRS12IP1 antibody was raised in rabbit using the N terminal of SFRS12IP1 as the immunogen</p>

<p>Purified Polyclonal PLA2G4A antibody</p>

<p>PTPN2 antibody was raised using the middle region of PTPN2 corresponding to a region with amino acids ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN</p>

<p>MIS12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI</p>

<p>C9ORF46 antibody was raised using the middle region of C9Orf46 corresponding to a region with amino acids AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL</p>

<p>FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE</p>

<p>The Cytokeratin 8 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the virus surface antigen and has been shown to have cytotoxic effects on infected cells. Additionally, this antibody has interferon-neutralizing properties, making it a valuable tool for studying the immune response to viral infections. The Cytokeratin 8 antibody is produced using advanced techniques and is available in both monoclonal and polyclonal forms. It is supplied in a buffered solution to ensure stability and can be activated for use in various applications, including immunohistochemistry and flow cytometry. With its high specificity and strong antigen-antibody reaction, the Cytokeratin 8 antibody is an essential tool for researchers studying viral pathogenesis and host immune responses.</p>

<p>FAM14A antibody was raised using the middle region of FAM14A corresponding to a region with amino acids SVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE</p>

<p>MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT</p>

<p>SLCO1A2 antibody was raised using the middle region of SLCO1A2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC</p>

<p>Purified Polyclonal MKK3/6 antibody</p>

<p>OTUD6A antibody was raised in rabbit using the N terminal of OTUD6A as the immunogen</p>

<p>NCAPH antibody was raised using the C terminal of NCAPH corresponding to a region with amino acids TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG</p>

<p>GUCA1B antibody was raised in rabbit using the N terminal of GUCA1B as the immunogen</p>

<p>The GALR2 antibody is a highly specialized monoclonal antibody that belongs to the field of Life Sciences. It is designed to target and bind to GALR2, a receptor protein involved in various cellular processes. This antibody has been extensively studied for its potential applications in research and therapeutic development.</p>

<p>RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG</p>

<p>ZNF799 antibody was raised in rabbit using the middle region of ZNF799 as the immunogen</p>

<p>ZBTB26 antibody was raised in rabbit using the N terminal of ZBTB26 as the immunogen</p>

<p>ZNF397 antibody was raised in rabbit using the middle region of ZNF397 as the immunogen</p>

<p>B3GNT7 antibody was raised using the N terminal of B3GNT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR</p>

<p>LRRC8A antibody was raised using the N terminal of LRRC8A corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK</p>

<p>ZFP62 antibody was raised in rabbit using the middle region of ZFP62 as the immunogen</p>

<p>AIMP2 antibody was raised in rabbit using the N terminal of AIMP2 as the immunogen</p>

<p>The p53 antibody is a highly specialized monoclonal antibody that targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody specifically binds to the p53 protein, allowing for its detection and analysis in various research applications. The p53 antibody has been widely used in studies related to cancer research, as mutations in the p53 gene are commonly associated with the development of tumors. Additionally, this antibody has also been utilized in investigations focused on lipase activity, growth factors, adipose tissue biology, and other areas within the field of life sciences. With its high specificity and sensitivity, the p53 antibody is an invaluable tool for researchers aiming to gain insights into cellular processes and disease mechanisms.</p>

<p>Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY</p>

<p>MEGF11 antibody was raised in rabbit using the middle region of MEGF11 as the immunogen</p>

<p>ANKH antibody was raised using a synthetic peptide corresponding to a region with amino acids SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK</p>

<p>Resistin antibody was raised in goat using highly pure recombinant human resistin as the immunogen.</p>

<p>MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY</p>

<p>PI4KB antibody was raised in rabbit using the middle region of PI4KB as the immunogen</p>

<p>KLHL14 antibody was raised in rabbit using the N terminal of KLHL14 as the immunogen</p>

<p>COX3 antibody was raised using the C terminal of COX3 corresponding to a region with amino acids FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH</p>

<p>Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM</p>

<p>Purified Polyclonal PLA2G4A antibody</p>

<p>RNF148 antibody was raised using the C terminal of RNF148 corresponding to a region with amino acids PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP</p>

<p>The SOCS1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the activity of interleukin-6, a key growth factor involved in various cellular processes. This antibody works by binding to interleukin-6 and preventing its interaction with cell surface receptors.</p>

<p>PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids  STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL</p>

<p>TUSC4 antibody was raised in rabbit using the middle region of TUSC4 as the immunogen</p>

<p>Dgat2 antibody was raised in rabbit using the C terminal of Dgat2 as the immunogen</p>

<p>PRMT3 antibody was raised in rabbit using the middle region of PRMT3 as the immunogen</p>

<p>C19ORF28 antibody was raised using the middle region of C19Orf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD</p>

<p>BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY</p>

<p>Slc9a3r2 antibody was raised in rabbit using the N terminal of Slc9a3r2 as the immunogen</p>

<p>GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST</p>

<p>BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA</p>

<p>ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY</p>

<p>CDC26 antibody was raised in rabbit using the C terminal of CDC26 as the immunogen</p>

<p>DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS</p>

<p>ZNF555 antibody was raised in rabbit using the C terminal of ZNF555 as the immunogen</p>

<p>The BRCA1 antibody is a polyclonal antibody that specifically targets the growth factor receptor in cells. It binds to the apical membrane of cells and inhibits the interaction between the growth factor and its receptor, thereby blocking cell signaling pathways involved in cell proliferation. The BRCA1 antibody is commonly used in research assays to study the effects of growth factors on cell behavior. Additionally, it can be used as a monoclonal antibody for diagnostic purposes, particularly in detecting abnormal levels of epidermal growth factor receptors in cancer cells. This antibody has also been shown to have potential therapeutic applications, such as targeting human folate receptors or collagen glycosylation inhibitors. Furthermore, it can be conjugated with drugs or phosphatase enzymes for targeted therapy or detection purposes, respectively.</p>

<p>ZIC4 antibody was raised in rabbit using the N terminal of ZIC4 as the immunogen</p>

<p>ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH</p>

<p>SLC18A1 antibody was raised in rabbit using the N terminal of SLC18A1 as the immunogen</p>

<p>FLJ13798 antibody was raised in rabbit using the C terminal of FLJ13798 as the immunogen</p>

<p>C14orf177 antibody was raised in rabbit using the N terminal of C14orf177 as the immunogen</p>

<p>NLRP2 antibody was raised in rabbit using the C terminal of NLRP2 as the immunogen</p>

<p>TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS</p>

<p>CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL</p>

<p>CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLN</p>

<p>DUSP5 antibody was raised in rabbit using the middle region of DUSP5 as the immunogen</p>

<p>ZNF579 antibody was raised in rabbit using the middle region of ZNF579 as the immunogen</p>

<p>MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV</p>

<p>Purified Polyclonal AIRE antibody</p>

<p>GABRA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL</p>

<p>IL17F antibody was raised in rabbit using highly pure recombinant human IL-17F as the immunogen.</p>

<p>ZNF614 antibody was raised in rabbit using the N terminal of ZNF614 as the immunogen</p>

<p>IRF8 antibody was raised in rabbit using the C terminal of IRF8 as the immunogen</p>

<p>Cpa3 antibody was raised in rabbit using the N terminal of Cpa3 as the immunogen</p>

<p>NBL1 antibody was raised using the middle region of NBL1 corresponding to a region with amino acids GLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE</p>

<p>EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI</p>

<p>CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD</p>

<p>STATH antibody was raised using the middle region of STATH corresponding to a region with amino acids MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP</p>

<p>NAP2 antibody was raised in goat using highly pure recombinant hNAP-2 as the immunogen.</p>

<p>SLC44A3 antibody was raised using the middle region of SLC44A3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI</p>

<p>SLCO1B1 antibody was raised in rabbit using the middle region of SLCO1B1 as the immunogen</p>

<p>TSSK2 antibody was raised in rabbit using the middle region of TSSK2 as the immunogen</p>

<p>THAP6 antibody was raised in rabbit using the middle region of THAP6 as the immunogen</p>

<p>Tmem106b antibody was raised in rabbit using the C terminal of Tmem106b as the immunogen</p>

<p>CCIN antibody was raised in rabbit using the N terminal of CCIN as the immunogen</p>

<p>MPPED2 antibody was raised using the C terminal of MPPED2 corresponding to a region with amino acids PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS</p>

<p>PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC</p>

<p>SLC22A18 antibody was raised using the middle region of SLC22A18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK</p>

<p>HERV antibody was raised in rabbit using residues 42-50 [QRPGNIDAPC] of the HERV protein as the immunogen.</p>

<p>ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV</p>

<p>MAGED2 antibody was raised in rabbit using the N terminal of MAGED2 as the immunogen</p>

<p>HNRNPU antibody was raised in rabbit using the C terminal of HNRNPU as the immunogen</p>

<p>Trp-p8 antibody was raised in rabbit using residues 278-292 RNQLEKYISERTIQD and the C terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein as the immunogen.</p>

<p>ZNF440 antibody was raised in rabbit using the middle region of ZNF440 as the immunogen</p>

<p>PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG</p>