Primary Antibodies

<p>ZBTB12 antibody was raised in rabbit using the N terminal of ZBTB12 as the immunogen</p>

<p>CPT1A antibody was raised using a synthetic peptide corresponding to a region with amino acids  LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN</p>

<p>ZNF93 antibody was raised in rabbit using the N terminal of ZNF93 as the immunogen</p>

<p>MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL</p>

<p>SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLR</p>

<p>TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF</p>

<p>p8 antibody was raised in rabbit using C terminus of the human p8 protein as the immunogen.</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant human MIP-1-alpha as the immunogen.</p>

<p>SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI</p>

<p>FBXL16 antibody was raised in rabbit using the N terminal of FBXL16 as the immunogen</p>

<p>Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL</p>

<p>PRKCH antibody was raised in rabbit using the N terminal of PRKCH as the immunogen</p>

<p>RELM beta antibody was raised in rabbit using highly pure recombinant murine RELMbeta as the immunogen.</p>

<p>JMJD3 antibody was raised in rabbit using the N terminal of JMJD3 as the immunogen</p>

<p>LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC</p>

<p>IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.</p>

<p>OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogen</p>

<p>C2ORF33 antibody was raised using the C terminal Of C2Orf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW</p>

<p>CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA</p>

<p>MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR</p>

<p>Symplekin antibody was raised using the middle region of SYMPK corresponding to a region with amino acids GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS</p>

<p>ZFP42 antibody was raised in rabbit using the N terminal of ZFP42 as the immunogen</p>

<p>CEACAM19 antibody was raised using the middle region of CEACAM19 corresponding to a region with amino acids MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNA</p>

<p>CLN6 antibody was raised using the middle region of CLN6 corresponding to a region with amino acids  LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL</p>

<p>OR1L8 antibody was raised in rabbit using the C terminal of OR1L8 as the immunogen</p>

<p>USP7 antibody was raised in rabbit using the middle region of USP7 as the immunogen</p>

<p>The ATF2 antibody is a highly specialized monoclonal antibody that is specifically designed to target and neutralize the activated form of ATF2, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of ATF2, leading to reduced cell growth and proliferation.</p>

<p>OAS1 antibody was raised in rabbit using the middle region of OAS1 as the immunogen</p>

<p>C4BPB antibody was raised using the N terminal of C4BPB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV</p>

<p>SPATA2 antibody was raised in rabbit using the C terminal of SPATA2 as the immunogen</p>

<p>ZNF584 antibody was raised in rabbit using the middle region of ZNF584 as the immunogen</p>

<p>ABHD1 antibody was raised in rabbit using the middle region of ABHD1 as the immunogen</p>

<p>Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC</p>

<p>TPD52 antibody was raised in rabbit using the C terminal of TPD52 as the immunogen</p>

<p>SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS</p>

<p>IL5 antibody was raised in rabbit using highly pure recombinant human IL-5 as the immunogen.</p>

<p>XPO5 antibody was raised in rabbit using the N terminal of XPO5 as the immunogen</p>

<p>MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN</p>

<p>IAPP antibody was raised in rabbit using the N terminal of IAPP as the immunogen</p>

<p>S100A9 antibody was raised using the N terminal of S100A9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK</p>

<p>GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA</p>

<p>FAM29A antibody was raised in rabbit using the middle region of FAM29A as the immunogen</p>

<p>MAOB antibody was raised using the N terminal of MAOB corresponding to a region with amino acids RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV</p>

<p>KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC</p>

<p>TEX14 antibody was raised in rabbit using the middle region of TEX14 as the immunogen</p>

<p>SLC22A10 antibody was raised using the middle region of SLC22A10 corresponding to a region with amino acids QTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDLTASRIGA</p>

<p>ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA</p>

<p>The Osteoprotegerin antibody is a polyclonal antibody that targets the glycoprotein Osteoprotegerin. This antibody is widely used in Life Sciences research to study various biological processes, including bone metabolism, cell proliferation, and apoptosis. Osteoprotegerin acts as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand), preventing its binding to RANK (Receptor Activator of Nuclear Factor Kappa-B) and thus inhibiting osteoclastogenesis and bone resorption.</p>

<p>OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogen</p>

<p>C12ORF49 antibody was raised using the C terminal Of C12Orf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY</p>

<p>B3GALT6 antibody was raised using the N terminal of B3GALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS</p>

<p>Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)</p>

<p>Wdr45l antibody was raised in rabbit using the N terminal of Wdr45l as the immunogen</p>

<p>WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV</p>

<p>ZNF689 antibody was raised in rabbit using the N terminal of ZNF689 as the immunogen</p>

<p>SMC1A antibody was raised in rabbit using the C terminal of SMC1A as the immunogen</p>

<p>IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT</p>

<p>Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG</p>

<p>SLC22A17 antibody was raised using the middle region of SLC22A17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM</p>

<p>CCNL2 antibody was raised in rabbit using the N terminal of CCNL2 as the immunogen</p>

<p>PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK</p>

<p>C1ORF166 antibody was raised using the middle region of C1Orf166 corresponding to a region with amino acids GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ</p>

<p>HEMGN antibody was raised in rabbit using the N terminal of HEMGN as the immunogen</p>

<p>SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY</p>

<p>RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA</p>

<p>ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV</p>

<p>SUZ12 antibody was raised in rabbit using the middle region of SUZ12 as the immunogen</p>

<p>Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI</p>

<p>TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN</p>

<p>ZBTB3 antibody was raised in rabbit using the N terminal of ZBTB3 as the immunogen</p>

<p>Purified Polyclonal CDK5RAP3 antibody</p>

<p>KLF12 antibody was raised in rabbit using the N terminal of KLF12 as the immunogen</p>

<p>GFAP antibody was raised in rabbit using the C terminus of the 50 kDa human protein as the immunogen.</p>

<p>ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND</p>

<p>SETD4 antibody was raised in rabbit using the C terminal of SETD4 as the immunogen</p>

<p>HDGFRP3 antibody was raised in rabbit using the middle region of HDGFRP3 as the immunogen</p>

<p>CCL7 antibody was raised in rabbit using the N terminal of CCL7 as the immunogen</p>

<p>Wnt10a antibody was raised in rabbit using the middle region of Wnt10a as the immunogen</p>

<p>C17ORF78 antibody was raised using the middle region of C17Orf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA</p>

<p>LBX2 antibody was raised in rabbit using the middle region of LBX2 as the immunogen</p>

<p>USP2 antibody was raised in rabbit using the N terminal of USP2 as the immunogen</p>

<p>AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY</p>

<p>MFRP antibody was raised using the middle region of MFRP corresponding to a region with amino acids HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS</p>

<p>SPAG6 antibody was raised in rabbit using the middle region of SPAG6 as the immunogen</p>

<p>ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen</p>

<p>Irf2bp1 antibody was raised in rabbit using the N terminal of Irf2bp1 as the immunogen</p>

<p>B4GALNT1 antibody was raised using the middle region of B4GALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA</p>

<p>LOC390338 antibody was raised in rabbit using the middle region of LOC390338 as the immunogen</p>

<p>AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA</p>

<p>Purified Polyclonal CLIC4 antibody</p>

<p>LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP</p>

<p>COG5 antibody was raised in rabbit using the N terminal of COG5 as the immunogen</p>

<p>PWP1 antibody was raised in rabbit using the C terminal of PWP1 as the immunogen</p>

<p>SLC4A5 antibody was raised using the middle region of SLC4A5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL</p>

<p>PKD2 antibody was raised in rabbit using human PKD2 protein as the immunogen.</p>

<p>DRAM antibody was raised in rabbit using the N terminal of DRAM as the immunogen</p>

<p>C9ORF127 antibody was raised using the N terminal Of C9Orf127 corresponding to a region with amino acids MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS</p>

<p>FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV</p>

<p>SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF</p>

<p>TRAIL receptor 4 antibody was raised in rabbit using N terminus of the mature human TRAIL-R4 protein as the immunogen.</p>

<p>ZNF550 antibody was raised in rabbit using the N terminal of ZNF550 as the immunogen</p>

<p>DNM1L antibody was raised in rabbit using the N terminal of DNM1L as the immunogen</p>

<p>Rod1 antibody was raised in rabbit using the N terminal of Rod1 as the immunogen</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant rat TNF-alpha as the immunogen.</p>

<p>IL1 alpha antibody was raised in rabbit using highly pure recombinant human IL-1a as the immunogen.</p>

<p>Hoxb9 antibody was raised in rabbit using the middle region of Hoxb9 as the immunogen</p>

<p>Pleiotrophin antibody was raised using a synthetic peptide corresponding to a region with amino acids LNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEG</p>

<p>IL6 antibody was raised in rabbit using highly pure recombinant rat IL-6 as the immunogen.</p>

<p>BRF2 antibody was raised in rabbit using the middle region of BRF2 as the immunogen</p>

<p>Purified Polyclonal CD2BP2 antibody</p>

<p>RPS6KA2 antibody was raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR</p>

<p>The LKB1 antibody is a monoclonal antibody that specifically targets the growth hormone receptor. It is commonly used in Life Sciences research to study the role of this receptor in various cellular processes. The LKB1 antibody binds to the antigen on the growth hormone receptor, blocking its activity and preventing downstream signaling events. This antibody can be used in experiments to investigate the effects of inhibiting the growth hormone receptor, such as studying cell proliferation, differentiation, and survival. Additionally, the LKB1 antibody can be used in combination with other antibodies or inhibitors to explore potential therapeutic applications. With its high specificity and affinity for the target protein, the LKB1 antibody is a valuable tool for researchers in the field of molecular biology and drug discovery.</p>

<p>C3ORF64 antibody was raised using the C terminal Of C3Orf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL</p>

<p>PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQD</p>

<p>SLC45A3 antibody was raised using the middle region of SLC45A3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS</p>

<p>CAND2 antibody was raised in rabbit using the N terminal of CAND2 as the immunogen</p>

<p>GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW</p>

<p>SLC39A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS</p>

<p>ZNF707 antibody was raised in rabbit using the N terminal of ZNF707 as the immunogen</p>

<p>BTNL8 antibody was raised in rabbit using the middle region of BTNL8 as the immunogen</p>

<p>SIGLEC6 antibody was raised using the middle region of SIGLEC6 corresponding to a region with amino acids FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT</p>

<p>NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP</p>

<p>NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI</p>

<p>Esrra antibody was raised in rabbit using the C terminal of Esrra as the immunogen</p>

<p>PYGO1 antibody was raised in rabbit using the N terminal of PYGO1 as the immunogen</p>

<p>Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL</p>

<p>ZNF550 antibody was raised in rabbit using the N terminal of ZNF550 as the immunogen</p>

<p>LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP</p>

<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>

<p>Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>The MARK antibody is a monoclonal antibody that specifically targets and binds to the activated form of fatty acid. It is designed to recognize and interact with a specific antigen, such as interleukins or IFN-gamma, which are involved in various biological processes including cell growth and immune response. This antibody can be used in life sciences research to study the role of these molecules in different pathways and diseases. Additionally, the MARK antibody can also be utilized as an inhibitor by blocking the interaction between the targeted molecule and its receptors, thus modulating specific cellular functions. With its high specificity and affinity, this antibody is a valuable tool for researchers in their quest to understand complex biological mechanisms.</p>

<p>SCAMP3 antibody was raised in rabbit using the N terminal of SCAMP3 as the immunogen</p>

<p>CANX antibody was raised in rabbit using the middle region of CANX as the immunogen</p>

<p>RGS9 antibody was raised using the middle region of RGS9 corresponding to a region with amino acids LKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWES</p>

<p>TREML2 antibody was raised in rabbit using the N terminal of TREML2 as the immunogen</p>

<p>Mouse monoclonal S100 antibody (Prediluted for IHC)</p>

<p>Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE</p>

<p>MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen</p>

<p>ZNF91 antibody was raised in rabbit using the N terminal of ZNF91 as the immunogen</p>

<p>Purified Polyclonal CD246 antibody</p>

<p>SERPINE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA</p>

<p>MAGEC2 antibody was raised in rabbit using the N terminal of MAGEC2 as the immunogen</p>

<p>SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV</p>

<p>FLJ10490 antibody was raised in rabbit using the middle region of FLJ10490 as the immunogen</p>

<p>MSI1 antibody was raised in rabbit using residues 5-21 [APQPGLASPDSPHDPCK] of the human mushashi protein as the immunogen.</p>

<p>PHOSPHO2 antibody was raised in rabbit using the N terminal of PHOSPHO2 as the immunogen</p>

<p>SLC6A2 antibody was raised in rabbit using the middle region of SLC6A2 as the immunogen</p>

<p>Affinity purified Goat polyclonal MSR Type 1 antibody</p>

<p>ADORA2B antibody was raised in rabbit using the C terminal of ADORA2B as the immunogen</p>

<p>RANTES antibody was raised in rabbit using highly pure recombinant rat RANTES as the immunogen.</p>

<p>Purified Polyclonal EMP antibody</p>

<p>C1QTNF1 antibody was raised using the N terminal of C1QTNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS</p>

<p>ZXDA antibody was raised in rabbit using the middle region of ZXDA as the immunogen</p>

<p>DAPK1 antibody was raised using the N terminal of DAPK1 corresponding to a region with amino acids MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK</p>

<p>DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE</p>

<p>FOXO3A antibody was raised in rabbit using the C terminal of FOXO3A as the immunogen</p>

<p>CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE</p>

<p>PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE</p>

<p>TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR</p>

<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL</p>

<p>Hmx3 antibody was raised in rabbit using the middle region of Hmx3 as the immunogen</p>

<p>TMEM176A antibody was raised using the middle region of TMEM176A corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ</p>

<p>Fibrinogen Alpha antibody was raised using the middle region of FGA corresponding to a region with amino acids SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK</p>

<p>PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL</p>

<p>ZNF385D antibody was raised in rabbit using the N terminal of ZNF385D as the immunogen</p>

<p>DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS</p>

<p>ZFP28 antibody was raised in rabbit using the middle region of ZFP28 as the immunogen</p>

<p>eIF5A2 antibody was raised in rabbit using residues 108-122 [VREDLKLPEGELGKE] of the 17 kDa human, mouse and rat EIF5A2 protein as the immunogen.</p>

<p>RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY</p>

<p>ZNF511 antibody was raised in rabbit using the N terminal of ZNF511 as the immunogen</p>

<p>NET antibody was raised in rabbit using a 22 amino acid peptide of rat NET as the immunogen.</p>

<p>TM4SF20 antibody was raised using the middle region of TM4SF20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG</p>

<p>Purified Polyclonal Histone H1.0 antibody</p>