Primary Antibodies

<p>Purified Polyclonal SHPTP2 antibody</p>

<p>ZNF226 antibody was raised in rabbit using the C terminal of ZNF226 as the immunogen</p>

<p>Meis3 antibody was raised in rabbit using the C terminal of Meis3 as the immunogen</p>

<p>ADNP antibody was raised in rabbit using human 114 kDA hADNP protein as the immunogen.</p>

<p>FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK</p>

<p>ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC</p>

<p>Pnpla6 antibody was raised in rabbit using the C terminal of Pnpla6 as the immunogen</p>

<p>SLC6A15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS</p>

<p>Rest antibody was raised in rabbit using the middle region of Rest as the immunogen</p>

<p>PHF11 antibody was raised in rabbit using the middle region of PHF11 as the immunogen</p>

<p>The PKR antibody is a monoclonal antibody that targets the protein kinase R (PKR). PKR is an important player in antiviral defense and regulates various cellular processes. This antibody specifically recognizes the glycoprotein and can be used for applications such as electrophoresis, antigen-antibody reactions, and neutralization assays. It has been widely used in research studies involving mesenchymal stem cells, fatty acid metabolism, chemokine-like molecules, and reactive oxygen species. Additionally, this antibody has shown potential in therapeutic applications for intraocular diseases. With its high specificity and ability to target PKR, this antibody is a valuable tool for researchers studying antiviral mechanisms and exploring new treatment options.</p>

<p>Purified Polyclonal EDG7 antibody</p>

<p>TAL2 antibody was raised in rabbit using the N terminal of TAL2 as the immunogen</p>

<p>SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED</p>

<p>PSMB9 antibody was raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE</p>

<p>Uap1l1 antibody was raised in rabbit using the middle region of Uap1l1 as the immunogen</p>

<p>Mouse monoclonal CA 19-9 antibody (Prediluted for IHC)</p>

<p>WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN</p>

<p>TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR</p>

<p>MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP</p>

<p>MTVR antibody was raised in rabbit using residues 152-163 [DDEEPPDASLPPC] of the 20 kDa MMTV-R as the immunogen.</p>

<p>KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR</p>

<p>IL19 antibody was raised in rabbit using highly pure recombinant human IL-19 as the immunogen.</p>

<p>Perilipin A antibody was raised in rabbit using a synthetic peptide corresponding to the residues C E(502) P I L G R T Q Y S Q L R K K S(517) of rat Perilipin A as the immunogen.</p>

<p>DHRS7B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA</p>

<p>NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF</p>

<p>Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ</p>

<p>MRE11A antibody was raised in rabbit using the N terminal of MRE11A as the immunogen</p>

<p>C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL</p>

<p>DPYSL2 antibody was raised using the middle region of DPYSL2 corresponding to a region with amino acids NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR</p>

<p>Purified Polyclonal SHARP1 antibody</p>

<p>RHOT1 antibody was raised using the middle region of RHOT1 corresponding to a region with amino acids ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR</p>

<p>NEI3 antibody was raised in rabbit using residues 164-177 (LRAESEVKKQKGRMLG) of the human NEI3 protein as the immunogen.</p>

<p>DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT</p>

<p>C2orf60 antibody was raised in rabbit using the middle region of C2ORF60 as the immunogen</p>

<p>LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen</p>

<p>Carboxypeptidase D antibody was raised using the N terminal of CPD corresponding to a region with amino acids SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPP</p>

<p>LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE</p>

<p>DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE</p>

<p>Purified Polyclonal p116 Rip antibody</p>

<p>SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY</p>

<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL</p>

<p>ZNF610 antibody was raised in rabbit using the N terminal of ZNF610 as the immunogen</p>

<p>FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE</p>

<p>The AIM2 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to AIM2, a protein that plays a crucial role in the activation of inflammasomes. By binding to AIM2, this antibody inhibits its function, preventing the activation of downstream signaling pathways that lead to inflammation and cell death.</p>

<p>SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogen</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>

<p>PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS</p>

<p>Lig3 antibody was raised in rabbit using the middle region of Lig3 as the immunogen</p>

<p>Purified Polyclonal TRPS1 antibody</p>

<p>PRDM9 antibody was raised in rabbit using the middle region of PRDM9 as the immunogen</p>

<p>FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP</p>

<p>SLC39A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL</p>

<p>IFN gamma antibody was raised in goat using highly pure recombinant rat IFN-gamma as the immunogen.</p>

<p>IL17 antibody was raised in rabbit using highly pure recombinant hIL-17A as the immunogen.</p>

<p>ARMC8 antibody was raised in rabbit using the N terminal of ARMC8 as the immunogen</p>

<p>Tmem147 antibody was raised in rabbit using the N terminal of Tmem147 as the immunogen</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR</p>

<p>BDNF antibody was raised in rabbit using highly pure recombinant human BDNF as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified Polyclonal ACSL6 antibody</p>

<p>ATP11B antibody was raised using the N terminal of ATP11B corresponding to a region with amino acids DIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGETNLKTHVAVPETA</p>

<p>Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG</p>

<p>FAM20A antibody was raised using the N terminal of FAM20A corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF</p>

<p>Apof antibody was raised in rabbit using the C terminal of Apof as the immunogen</p>

<p>JMJD2C antibody was raised in rabbit using the middle region of JMJD2C as the immunogen</p>

<p>SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL</p>

<p>PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED</p>

<p>PF4 antibody was raised in rabbit using highly pure recombinant hPF-4 as the immunogen.</p>

<p>ZNF258 antibody was raised in rabbit using the middle region of ZNF258 as the immunogen</p>

<p>BTBD15 antibody was raised in rabbit using the C terminal of BTBD15 as the immunogen</p>

<p>SREBF1 antibody was raised in rabbit using the N terminal of SREBF1 as the immunogen</p>

<p>PARK7 antibody was raised in rabbit using residues 167-189 (AIVEALNGKEVAAQVKAPLVLKD) of human PARK7 (DJ-1) as the immunogen.</p>

<p>RELM alpha antibody was raised in rabbit using residues 31-44 of the mouse RELMalpha protein as the immunogen.</p>

<p>ZBTB33 antibody was raised in rabbit using the N terminal of ZBTB33 as the immunogen</p>

<p>RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA</p>

<p>PER2 antibody was raised in rabbit using the middle region of PER2 as the immunogen</p>

<p>EVX1 antibody was raised in rabbit using the N terminal of EVX1 as the immunogen</p>

<p>Dusp11 antibody was raised in rabbit using the N terminal of Dusp11 as the immunogen</p>

<p>PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL</p>

<p>RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER</p>

<p>Psenen antibody was raised in rabbit using the N terminal of Psenen as the immunogen</p>

<p>ASCL4 antibody was raised in rabbit using the N terminal of ASCL4 as the immunogen</p>

<p>DUSP12 antibody was raised in rabbit using the N terminal of DUSP12 as the immunogen</p>

<p>TMCC1 antibody was raised using the C terminal of TMCC1 corresponding to a region with amino acids ERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYERARDIQEALEAC</p>

<p>IL10 antibody was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.</p>

<p>KIF2A antibody was raised using the N terminal of KIF2A corresponding to a region with amino acids IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPS</p>

<p>SLC25A35 antibody was raised using the N terminal of SLC25A35 corresponding to a region with amino acids  DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI</p>

<p>ZNF138 antibody was raised in rabbit using the middle region of ZNF138 as the immunogen</p>

<p>The Cytokeratin 18 antibody is a highly activated monoclonal antibody that specifically targets cytokeratin 18, a protein found in human serum. This antibody is cationic in nature and has been extensively studied for its ability to bind to cytokeratin 18 and induce cytotoxic effects. It has been used in various research applications, including immunohistochemistry and western blotting, to detect the presence of cytokeratin 18 in different tissues and cell types.</p>

<p>EHMT2 antibody was raised in rabbit using the N terminal of EHMT2 as the immunogen</p>

<p>CFTR antibody was raised in rabbit using a synthetic peptide, G(103) R I I A S Y D P D N K E E R(117), as the immunogen.</p>

<p>PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE</p>

<p>Goat anti-rabbit IgG Fc was raised in goat using rabbit igG, Fc fragment as the immunogen.</p>

<p>SYT3 antibody was raised using the N terminal of SYT3 corresponding to a region with amino acids VSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGG</p>

<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>

<p>SpUlp2 antibody was raised in rabbit using residues 622-635 [SNNERQSLSSGSND] of the SpUlp2 protein as the immunogen.</p>

<p>Pigs antibody was raised in rabbit using the C terminal of Pigs as the immunogen</p>

<p>SLC34A3 antibody was raised in rabbit using the middle region of SLC34A3 as the immunogen</p>

<p>Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV</p>

<p>NRP1 antibody was raised in rabbit using the N terminal of NRP1 as the immunogen</p>

<p>KLF14 antibody was raised in rabbit using the N terminal of KLF14 as the immunogen</p>

<p>SPINT1 antibody was raised in rabbit using the C terminal of SPINT1 as the immunogen</p>

<p>DMBX1 antibody was raised in rabbit using the middle region of DMBX1 as the immunogen</p>

<p>ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogen</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV</p>

<p>IGF BP7 antibody was raised in rabbit using highly pure recombinant human IGF-BP7 as the immunogen.</p>

<p>FOXN4 antibody was raised in rabbit using the C terminal of FOXN4 as the immunogen</p>

<p>Purified Polyclonal CK1 alpha antibody</p>

<p>CYP4X1 antibody was raised using the middle region of CYP4X1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP</p>

<p>Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV</p>

<p>ZNFN1A5 antibody was raised in rabbit using the N terminal of ZNFN1A5 as the immunogen</p>

<p>PTCH2 antibody was raised in rabbit using residues 226-235 [GPFASLEGFR] of the human PTCH2 protein as the immunogen.</p>

<p>CDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDRED</p>

<p>Abca1 antibody was raised in rabbit using the middle region of Abca1 as the immunogen</p>

<p>IKZF3 antibody was raised in rabbit using the C terminal of IKZF3 as the immunogen</p>

<p>Mbtd1 antibody was raised in rabbit using the middle region of Mbtd1 as the immunogen</p>

<p>FGF17 antibody was raised in goat using highly pure recombinant human FGF-17 as the immunogen.</p>

<p>Purified Polyclonal TRA2A antibody</p>

<p>ARHGAP20 antibody was raised in rabbit using the middle region of ARHGAP20 as the immunogen</p>

<p>SLC10A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP</p>

<p>CACNB2 antibody was raised in rabbit using the C terminal of CACNB2 as the immunogen</p>

<p>Purified Polyclonal HARS antibody</p>

<p>PHF2 antibody was raised in rabbit using residues 70-82 [KHGPGPTPDVKRVC] of the 120 kDa PHF protein as the immunogen.</p>

<p>PYGO2 antibody was raised in rabbit using the N terminal of PYGO2 as the immunogen</p>

<p>ZNF783 antibody was raised in rabbit using the middle region of ZNF783 as the immunogen</p>

<p>ARC antibody was raised in rabbit using the N terminal of ARC as the immunogen</p>

<p>KIAA1618 antibody was raised in rabbit using the N terminal of KIAA1618 as the immunogen</p>

<p>GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE</p>

<p>C21ORF62 antibody was raised using the middle region of C21Orf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL</p>

<p>HSD3B2 antibody was raised using the N terminal of HSD3B2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN</p>

<p>ALDH3A2 antibody was raised using the C terminal of ALDH3A2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG</p>

<p>FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogen</p>

<p>GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW</p>

<p>Purified Polyclonal KIAA1967 antibody</p>

<p>PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY</p>

<p>HKR1 antibody was raised in rabbit using the N terminal of HKR1 as the immunogen</p>

<p>SPIC antibody was raised in rabbit using the middle region of SPIC as the immunogen</p>

<p>FBXL11 antibody was raised in rabbit using the N terminal of FBXL11 as the immunogen</p>

<p>Collagen type V antibody was raised in rabbit using collagen type V from human and bovine placenta as the immunogen.</p>

<p>ZNF431 antibody was raised in rabbit using the middle region of ZNF431 as the immunogen</p>

<p>KLHDC3 antibody was raised in rabbit using the N terminal of KLHDC3 as the immunogen</p>

<p>ZNF228 antibody was raised in rabbit using the N terminal of ZNF228 as the immunogen</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV</p>

<p>LBX2 antibody was raised in rabbit using the middle region of LBX2 as the immunogen</p>

<p>ZNF131 antibody was raised in rabbit using the N terminal of ZNF131 as the immunogen</p>

<p>The EEF2 antibody is a highly specialized product used in the field of Life Sciences. It is a colloidal immunoassay that specifically targets the EEF2 protein, also known as Elongation Factor 2. This antibody is available in both polyclonal and monoclonal forms, offering researchers a variety of options for their experiments.</p>

<p>PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR</p>

<p>Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG</p>

<p>BD1 antibody was raised in rabbit using highly pure recombinant human BD-1 as the immunogen.</p>

<p>PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL</p>

<p>Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY</p>

<p>RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS</p>

<p>NKIRAS2 antibody was raised using the C terminal of NKIRAS2 corresponding to a region with amino acids VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG</p>

<p>DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen</p>

<p>ZNF154 antibody was raised in rabbit using the N terminal of ZNF154 as the immunogen</p>

<p>GRM6 antibody was raised in rabbit using the C terminal of GRM6 as the immunogen</p>

<p>PRAC antibody was raised in rabbit using human PRAC protein as the immunogen.</p>

<p>Oasl1 antibody was raised in rabbit using the C terminal of Oasl1 as the immunogen</p>

<p>CNTF antibody was raised in rabbit using highly pure recombinant rat CNTF as the immunogen.</p>

<p>GABRB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT</p>

<p>Arf4 antibody was raised in rabbit using the N terminal of Arf4 as the immunogen</p>

<p>TMEM161A antibody was raised using the middle region of TMEM161A corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR</p>

<p>USP13 antibody was raised in rabbit using the N terminal of USP13 as the immunogen</p>

<p>CERKL antibody was raised in rabbit using the C terminal of CERKL as the immunogen</p>

<p>Alpha 1 Antichymotrypsin antibody was raised in goat using Human Alpha-1-Antichymotrypsin as the immunogen.</p>

<p>TP53INP1 antibody was raised in rabbit using the C terminal of TP53INP1 as the immunogen</p>

<p>MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA</p>