Primary Antibodies

<p>Atp4b antibody was raised in rabbit using the C terminal of Atp4b as the immunogen</p>

<p>Frizzled antibody was raised in rabbit using residues 1-12 [MRGPGTAASHSPC] of murine fz7 as the immunogen.</p>

<p>SLC39A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP</p>

<p>ZBTB40 antibody was raised in rabbit using the N terminal of ZBTB40 as the immunogen</p>

<p>BSND antibody was raised in rabbit using the middle region of BSND as the immunogen</p>

<p>AGPAT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE</p>

<p>The CDC2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It specifically targets the CDC2 protein, which plays a crucial role in cell division and growth. By inhibiting the activity of CDC2, this antibody can help researchers study the effects of growth factors and inhibitors on cell proliferation.</p>

<p>UBL7 antibody was raised in rabbit using the N terminal of UBL7 as the immunogen</p>

<p>CPT1B antibody was raised using a synthetic peptide corresponding to a region with amino acids DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA</p>

<p>CA7 antibody was raised in rabbit using the C terminal of CA7 as the immunogen</p>

<p>Purified Polyclonal BAIAP2L1 antibody</p>

<p>KLK-L14 antibody was raised in rabbit using residues 239-251 [KYRSWIEETMRDK] of the 27 kDa human KLK14 protein as the immunogen.</p>

<p>TP53I13 antibody was raised in rabbit using the C terminal of TP53I13 as the immunogen</p>

<p>Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY</p>

<p>ZIC4 antibody was raised in rabbit using the middle region of ZIC4 as the immunogen</p>

<p>TMEM176A antibody was raised in rabbit using the N terminal of TMEM176A as the immunogen</p>

<p>C14ORF180 antibody was raised using the N terminal Of C14Orf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA</p>

<p>SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF</p>

<p>The Cortactin antibody is a highly specialized antibody that plays a crucial role in various life sciences research applications. This antibody specifically targets the protein known as Cortactin, which is a key regulator of actin cytoskeleton dynamics.</p>

<p>NCKAP1L antibody was raised in rabbit using the N terminal of NCKAP1L as the immunogen</p>

<p>PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS</p>

<p>TRAIL antibody was raised in rabbit using residues 223-235 [MKSARNSCWSKDA] of the C terminus of the TRAIL protein as the immunogen.</p>

<p>OR2T29 antibody was raised in rabbit using the C terminal of OR2T29 as the immunogen</p>

<p>SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids  ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI</p>

<p>POGZ antibody was raised in rabbit using the C terminal of POGZ as the immunogen</p>

<p>Atg9a antibody was raised in rabbit using the C terminal of Atg9a as the immunogen</p>

<p>C1qtnf2 antibody was raised in rabbit using the middle region of C1qtnf2 as the immunogen</p>

<p>Rhebl1 antibody was raised in rabbit using the N terminal of Rhebl1 as the immunogen</p>

<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids  MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN</p>

<p>PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA</p>

<p>ATXN7 antibody was raised in rabbit using the middle region of ATXN7 as the immunogen</p>

<p>Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE</p>

<p>SDF1 alpha antibody was raised in rabbit using highly pure recombinant human SDF-1-alpha as the immunogen.</p>

<p>Fgf1 antibody was raised in rabbit using the N terminal of Fgf1 as the immunogen</p>

<p>PHGDH antibody was raised using the middle region of PHGDH corresponding to a region with amino acids CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF</p>

<p>Sema3f antibody was raised in rabbit using the N terminal of Sema3f as the immunogen</p>

<p>LOC732272 antibody was raised in rabbit using the N terminal of LOC732272 as the immunogen</p>

<p>HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD</p>

<p>DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Rad21 antibody was raised in rabbit using the C terminal of Rad21 as the immunogen</p>

<p>COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML</p>

<p>PINX1 antibody was raised in rabbit using the middle region of PINX1 as the immunogen</p>

<p>The CD137L antibody is a powerful tool in the field of life sciences. It has the ability to induce lysis, or cell death, in certain cells. This antibody specifically targets parathyroid hormone-related protein (PTHrP), fibronectin, insulin, E-cadherin, and β-catenin. It is a polyclonal antibody, which means it is derived from multiple sources and can recognize various epitopes on its target proteins.</p>

<p>TREML2 antibody was raised using the middle region of TREML2 corresponding to a region with amino acids TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST</p>

<p>Nfkbiz antibody was raised in rabbit using the C terminal of Nfkbiz as the immunogen</p>

<p>NPFF2 antibody was raised in rabbit using human NPFF2 protein as the immunogen.</p>

<p>KLF17 antibody was raised in rabbit using the N terminal of KLF17 as the immunogen</p>

<p>RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS</p>

<p>ZNF517 antibody was raised in rabbit using the middle region of ZNF517 as the immunogen</p>

<p>SHC1 antibody was raised in rabbit using the C terminal of SHC1 as the immunogen</p>

<p>MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE</p>

<p>BMP2 antibody was raised in rabbit using highly pure human recombinant human BMP-2 as the immunogen.</p>

<p>Jmjd8 antibody was raised in rabbit using the C terminal of Jmjd8 as the immunogen</p>

<p>PIK3R1 antibody was raised in rabbit using the C terminal of PIK3R1 as the immunogen</p>

<p>KC antibody was raised in rabbit using highly pure recombinant murine KC as the immunogen.</p>

<p>Rabbit polyclonal Lysozyme antibody (Prediluted for IHC)</p>

<p>UNC5A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT</p>

<p>DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG</p>

<p>TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST</p>

<p>SH2D3C antibody was raised using the N terminal of SH2D3C corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids PRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSSTSQRISVELPVPI</p>

<p>ZNF587 antibody was raised in rabbit using the middle region of ZNF587 as the immunogen</p>

<p>Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR</p>

<p>METT10D antibody was raised in rabbit using the N terminal of METT10D as the immunogen</p>

<p>TECK antibody was raised in rabbit using highly pure recombinant human TECK as the immunogen.</p>

<p>TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC</p>

<p>MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE</p>

<p>PCSK2 antibody was raised in rabbit using the middle region of PCSK2 as the immunogen</p>

<p>Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS</p>

<p>Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS</p>

<p>RFXB antibody was raised in rabbit using residues 18-31 [ASELGDPEDPGEEAC] of the RFX-B protein as the immunogen.</p>

<p>Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ</p>

<p>ZNF566 antibody was raised in rabbit using the middle region of ZNF566 as the immunogen</p>

<p>P4HB antibody was raised using the N terminal of P4HB corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV</p>

<p>Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogen</p>

<p>PA2G4 antibody was raised in rabbit using the C terminal of PA2G4 as the immunogen</p>

<p>Angel1 antibody was raised in rabbit using the C terminal of Angel1 as the immunogen</p>

<p>Vps45 antibody was raised in rabbit using the C terminal of Vps45 as the immunogen</p>

<p>Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ</p>

<p>RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL</p>

<p>UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogen</p>

<p>CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV</p>

<p>NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE</p>

<p>SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND</p>

<p>FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ</p>

<p>FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS</p>

<p>LEC antibody was raised in goat using highly pure recombinant human LEC as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>WNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC</p>

<p>STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD</p>

<p>HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT</p>

<p>TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM</p>

<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR</p>

<p>Gal3st4 antibody was raised in rabbit using the C terminal of Gal3st4 as the immunogen</p>

<p>IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ</p>

<p>Gm527 antibody was raised in rabbit using the C terminal of Gm527 as the immunogen</p>

<p>PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL</p>

<p>Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET</p>

<p>CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS</p>

<p>Mouse monoclonal Cytokeratin AE1 antibody (Prediluted for IHC)</p>

<p>ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH</p>

<p>SLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM</p>

<p>Smarcd3 antibody was raised in rabbit using the C terminal of Smarcd3 as the immunogen</p>

<p>ZNF499 antibody was raised in rabbit using the middle region of ZNF499 as the immunogen</p>

<p>SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG</p>

<p>ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM</p>

<p>GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS</p>

<p>RP11-50D16.3 antibody was raised using the middle region of Rp11-50D16.3 corresponding to a region with amino acids LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL</p>

<p>CLACP antibody was raised in rabbit using residues 155-169 [KGEQGDQGPRMVFPK] of the NC2-2 region of human and mouse CLAC-P as the immunogen.</p>

<p>beta NGF antibody was raised in rabbit using highly pure recombinant human beta-NGF as the immunogen.</p>

<p>TWEAK antibody was raised in goat using highly pure recombinant human TWEAK as the immunogen.</p>

<p>The STING antibody is a polyclonal antibody that targets the Stimulator of Interferon Genes (STING) protein. This protein plays a crucial role in the immune response by activating the production of interferon and other cytokines. The STING antibody can be used in various life science applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>SELE antibody was raised in rabbit using the N terminal of SELE as the immunogen</p>

<p>Aldh4a1 antibody was raised in rabbit using the N terminal of Aldh4a1 as the immunogen</p>

<p>TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC</p>

<p>ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV</p>

<p>KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA</p>

<p>Purified Polyclonal HCFC1 antibody</p>

<p>PTPN1 antibody was raised using the middle region of PTPN1 corresponding to a region with amino acids SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL</p>

<p>FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL</p>

<p>Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY</p>

<p>ZNF415 antibody was raised in rabbit using the C terminal of ZNF415 as the immunogen</p>

<p>Purified Polyclonal CHRNA1 antibody</p>

<p>LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA</p>

<p>PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ</p>

<p>ZNF625 antibody was raised in rabbit using the N terminal of ZNF625 as the immunogen</p>

<p>M-CSF antibody was raised in goat using highly pure recombinant murine M-CSF as the immunogen.</p>

<p>LRRTM4 antibody was raised using the middle region of LRRTM4 corresponding to a region with amino acids FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQVVNTERSH</p>

<p>The SLC15A3 antibody is a highly versatile and effective tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SLC15A3 protein isoforms. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting.</p>

<p>CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE</p>

<p>CYP24A1 antibody was raised in rabbit using the C terminal of CYP24A1 as the immunogen</p>

<p>DACH2 antibody was raised in rabbit using the C terminal of DACH2 as the immunogen</p>

<p>Harbi1 antibody was raised in rabbit using the N terminal of Harbi1 as the immunogen</p>

<p>CD40L antibody was raised in goat using highly pure recombinant human sCD40L as the immunogen.</p>

<p>C14orf28 antibody was raised in rabbit using the middle region of C14orf28 as the immunogen</p>

<p>KIF3A antibody was raised using the C terminal of KIF3A corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR</p>

<p>SNAI1 antibody was raised in rabbit using the N terminal of SNAI1 as the immunogen</p>

<p>GRLF1 antibody was raised in rabbit using the N terminal of GRLF1 as the immunogen</p>

<p>ZFP3 antibody was raised in rabbit using the N terminal of ZFP3 as the immunogen</p>

<p>Abra antibody was raised in rabbit using the C terminal of Abra as the immunogen</p>

<p>HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR</p>

<p>Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN</p>

<p>CA5A antibody was raised in rabbit using the C terminal of CA5A as the immunogen</p>

<p>ZNF570 antibody was raised in rabbit using the middle region of ZNF570 as the immunogen</p>

<p>CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW</p>

<p>ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL</p>

<p>FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH</p>

<p>The BIK antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of BIK, a protein involved in regulating cell death. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been shown to inhibit the activity of BIK, preventing its interaction with other proteins and ultimately leading to a reduction in cell death. Additionally, the BIK antibody has been found to have neutralizing effects on reactive oxygen species, which are known to contribute to inflammation and tissue damage. This antibody can be used in a variety of applications, including studies involving human serum, interleukin-6, mesenchymal stem cells, and influenza hemagglutinin. Whether you're conducting cutting-edge research or developing innovative therapies, the BIK antibody is an invaluable tool for your scientific endeavors.</p>

<p>FBG2 antibody was raised in rabbit using residues 268-284 (SEAQPGQKHGQEEAAQS) of the human FBG2 protein as the immunogen.</p>

<p>GDNF antibody was raised in rabbit using highly pure recombinant human GDNF as the immunogen.</p>

<p>ITIH1 antibody was raised in rabbit using the C terminal of ITIH1 as the immunogen</p>

<p>Purified Polyclonal GCKR antibody</p>

<p>CMA1 antibody was raised in rabbit using the C terminal of CMA1 as the immunogen</p>

<p>Purified Polyclonal 14 3 3 zeta antibody</p>

<p>UCP3 antibody was raised in rabbit using an 18 amino acid peptide from rat UCP3 as the immunogen.</p>

<p>Gabra5 antibody was raised in rabbit using the middle region of Gabra5 as the immunogen</p>

<p>MLH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP</p>

<p>BBX antibody was raised in rabbit using the middle region of BBX as the immunogen</p>

<p>GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.</p>

<p>FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE</p>

<p>The S6K1 antibody is a highly effective inhibitor that specifically targets the S6 kinase 1 (S6K1) protein. This antibody is widely used in various research fields, including life sciences and molecular biology. It has been shown to effectively neutralize the activity of S6K1, which plays a crucial role in cell growth and proliferation.</p>

<p>Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN</p>

<p>KIAA0999 antibody was raised in rabbit using the middle region of KIAA0999 as the immunogen</p>

<p>P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI</p>

<p>Purified Polyclonal CSNK1G1 antibody</p>

<p>RFC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDK</p>

<p>ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL</p>

<p>TXNIP antibody was raised in rabbit using the middle region of TXNIP as the immunogen</p>

<p>KLK5 antibody was raised using the N terminal of KLK5 corresponding to a region with amino acids CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL</p>

<p>LYVE1 antibody was raised in rabbit using recombinant mouse soluble Lyve-1 as the immunogen.molecular weight ~50 kDa HC and ~25 kDa LC</p>

<p>SLC3A1 antibody was raised using the N terminal of SLC3A1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT</p>

<p>STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIK</p>

<p>Fbxo34 antibody was raised in rabbit using the N terminal of Fbxo34 as the immunogen</p>