Primary Antibodies

<p>Goat polyclonal Human CRP antibody</p>

<p>TSH antibody was raised in goat using human TSH whole molecule as the immunogen.</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Clonidine antibody was raised in rabbit using Clonidine-BSA as the immunogen.</p>

<p>Histone-H-3 antibody was raised in sheep using Intact calf histone H3 complexed with RNA as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp36 antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>

<p>Theophylline 8 antibody was raised in rabbit using theophylline-8 as the immunogen.</p>

<p>Phosphothreonine antibody was raised in rabbit using phosphothreoning as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Rabbit polyclonal HIV-2 antibody (biotin)</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Rabbit polyclonal HIV1-RT antibody</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (Biotin)</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (FITC)</p>

<p>SIV mac251 p28 antibody was raised in rabbit using full length recombinant p28 (SIVmac251) as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Estradiol 6,17 b antibody was raised in rabbit using Estradiol-17 beta-6-CMO-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV-1 antibody; IgG2b</p>

<p>Goat anti Human IgM + IgD antibody</p>

<p>Gentamicin antibody was raised in rabbit using gentamycin-KLH as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>

<p>Digoxin antibody was raised in rabbit using digoxin-BSA as the immunogen.</p>

<p>Histone 2B antibody was raised in sheep using Intact calf histone H2B-rRNA complex as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Thyroxine antibody was raised in rabbit using thyroxine-BSA as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp26 antibody; immunogen full length recombinant p26 (HIV-2 ROD) produced in E.coli expression system</p>

<p>Thyroxine antibody is a highly reactive collagen-based monoclonal antibody used in Life Sciences research. It is commonly used for the detection and quantification of thyroxine levels in human serum samples. This antibody specifically targets and binds to thyroxine, preventing its interaction with other molecules. The immobilization of this antibody on an electrode surface allows for efficient and sensitive detection of thyroxine levels. Additionally, studies have shown that this antibody has neutralizing effects on interleukin-6, a pro-inflammatory cytokine involved in various diseases. Furthermore, it has been observed that the binding of this antibody to thyroxine can inhibit the production of reactive oxygen species, making it potentially useful in antioxidant therapies.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Gastrin antibody was raised in rabbit using human gastrin as the immunogen.</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>Goat polyclonal PF4 antibody</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>Polyclonal Myoglobin antibody</p>

<p>Goat polyclonal Properdin antibody</p>

<p>Goat polyclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 50 ug/vial</p>

<p>Progesterone 17-OH antibody was raised in rabbit using 17-OH-Progesterone-3-CMO-BSA as the immunogen.</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>

<p>CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.</p>

<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>

<p>Digitoxigenin antibody was raised in goat using digitoxigenin as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in mouse using purified full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Progesterone antibody was raised in rabbit using progesterone as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Testosterone antibody was raised in sheep using 11-beta hydroxytestosterone as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human pituitary TSH affinity purified antigen as the immunogen.</p>

<p>Rabbit polyclonal NFkB regulatory factor antibody</p>

<p>Serotonin antibody was raised in sheep using serotonin-Tg as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>Mouse monoclonal HIV1 Nef N-terminal antibody (biotin)</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Goat anti Human IgE antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>