Primary Antibodies

<p>MTMR14 antibody was raised using the middle region of MTMR14 corresponding to a region with amino acids NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS</p>

<p>Rabbit polyclonal AFX antibody (Ser197)</p>

<p>The Elk1 antibody is a highly specific and potent tool used in various research applications. It is a recombinant monoclonal antibody that binds to Elk1, a transcription factor involved in the regulation of gene expression. This antibody has been extensively characterized and validated for its ability to detect and neutralize Elk1 protein isoforms.</p>

<p>MAML3 antibody was raised in mouse using recombinant Human Mastermind-Like 3 (Drosophila) (Maml3)</p>

<p>The BCAS4 antibody is a highly versatile and potent growth factor that exhibits antiviral and neuroprotective properties. It belongs to the class of interferons and is widely used in Life Sciences research. This monoclonal antibody plays a crucial role in various biochemical processes, including glycosylation and fatty acid metabolism.</p>

<p>Rabbit polyclonal SLC13A4 antibody</p>

<p>EGFR antibody was raised in mouse using human A431 membrane protein as the immunogen.</p>

<p>Purified Rabbit polyclonal TLP14 antibody</p>

<p>Rabbit polyclonal NudC antibody (Ser326)</p>

<p>Mouse monoclonal CD45RA antibody (allophycocyanin)</p>

<p>CD73 antibody was raised in mouse using recombinant human CD73 (27-252aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal CCR5 antibody (Ser349)</p>

<p>The Cathepsin S antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the activity of Cathepsin S, a proteolytic enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in studies involving mesenchymal stem cells, taxol, and other related compounds. It can be used for immobilization studies, as well as in vitro assays to measure enzyme activity. The Cathepsin S antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it an ideal tool for studying the role of Cathepsin S in various biological processes.</p>

<p>PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK</p>

<p>Rabbit polyclonal PHYH antibody</p>

<p>Purified Polyclonal Cav3.1 antibody</p>

<p>The SAA antibody is an anti-HER2 antibody-drug that targets the epidermal growth factor receptor (EGFR) pathway. It belongs to the class of monoclonal antibodies and is designed to inhibit the growth and proliferation of cancer cells. The SAA antibody specifically binds to HER2, a protein that is overexpressed in certain types of cancer, including breast cancer. By binding to HER2, the antibody prevents the activation of downstream signaling pathways that promote cell growth and survival. This targeted approach minimizes damage to healthy cells and reduces side effects associated with traditional chemotherapy drugs. The SAA antibody has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential as a treatment for HER2-positive cancers. With its high specificity and ability to block HER2 signaling, the SAA antibody represents a promising advancement in the field of targeted therapy for cancer.</p>

<p>Rabbit Polyclonal eIF4G antibody (Ser1232)</p>

<p>Rabbit polyclonal PP2A alpha antibody (Tyr307)</p>

<p>The BECN1 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody specifically targets BECN1, a protein involved in various cellular processes such as autophagy, iron homeostasis, and tumor suppression. The polyclonal antibodies are derived from human serum and provide a broad range of reactivity to different epitopes of BECN1. On the other hand, the monoclonal antibody offers high specificity by targeting specific amino acid residues.</p>

<p>PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV</p>

<p>Mouse monoclonal PAICS antibody</p>

<p>Syrian Hamster monoclonal NK cell antibody (PE)</p>

<p>Affinity purified Rabbit polyclonal RAD1 antibody</p>

<p>The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.</p>

<p>The CD27 antibody is a monoclonal antibody that specifically targets the CD27 molecule, a protein found on the surface of certain cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal NCAPH antibody</p>

<p>Rabbit polyclonal MP68 antibody (FITC)</p>

<p>Rabbit polyclonal PE2R3 antibody</p>

<p>The TNFR2 antibody is a highly specific antibody that targets a low pH target molecule. It belongs to the group of Polyclonal Antibodies and is widely used in the field of Life Sciences. This antibody can be used for various applications, including flow immunoassays and ultrasensitive detection.</p>

<p>AGA antibody was raised in rabbit using the middle region of AGA as the immunogen</p>

<p>Mouse monoclonal AK4 antibody</p>

The SERCA2 antibody is a monoclonal antibody that has cytotoxic effects and induces necrosis in targeted cells. It specifically targets the telomerase enzyme, which plays a crucial role in cell division and growth. The antibody has been shown to inhibit telomerase activity, leading to cell death through apoptosis. Additionally, this antibody has been found to have autoantibody properties, meaning it can target and attack healthy cells in the body. It can also bind to colloidal particles and interfere with their function. Furthermore, the SERCA2 antibody acts as a CXCR4 family kinase inhibitor, blocking the signaling pathway of chemokines. This inhibition reduces the production of superoxide, a highly reactive molecule involved in oxidative stress. In Life Sciences research, this antibody is commonly used to study growth factors such as hepatocyte growth factor and their effects on cellular processes. However, caution should be exercised when using this antibody as it may have nephrotoxic effects on kidney cells.

<p>Rabbit polyclonal PRPS1 antibody</p>

<p>Rabbit polyclonal PGBD3 antibody</p>

<p>Purified Rabbit polyclonal MADS94 antibody</p>

<p>Mouse monoclonal NIF3L1 antibody</p>

<p>The Src antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the Src protein, which plays a crucial role in various cellular processes such as cell growth, differentiation, and survival. This antibody has been shown to have neutralizing properties against the activity of Src, making it a valuable tool for studying its functions and downstream signaling pathways.</p>

<p>Mouse monoclonal ANAPC2 antibody</p>

<p>Rabbit Polyclonal CARM1 antibody (Ser228)</p>

<p>C7ORF43 antibody was raised using the middle region of C7Orf43 corresponding to a region with amino acids DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL</p>

<p>CYP51A1 antibody was raised in Rabbit using Human CYP51A1 as the immunogen</p>

<p>Rabbit polyclonal IGLL1 antibody</p>

<p>Rabbit polyclonal DGKI antibody</p>

<p>The BMP2 antibody is a highly specific diagnostic reagent that belongs to the class of antibodies. It is used to detect and analyze protein complexes involved in various biological processes, including the TGF-beta signaling pathway. This antibody has been shown to have specific reactivity towards inflammasome proteins, making it a valuable tool for studying the immune response. The BMP2 antibody can be used in various assays, such as fluorescent assays or polymerase chain reactions, to detect and quantify the presence of target proteins. In addition to its diagnostic applications, this monoclonal antibody has also been found to have immunomodulatory effects, potentially affecting cell function and promoting opsonophagocytic activity. With its wide range of applications in life sciences research, the BMP2 antibody is an essential tool for scientists studying protein interactions and cellular processes.</p>

<p>Purified Polyclonal CD178 antibody</p>

<p>Rb1 Monoclonal Antibody (HRP)</p>

<p>GIPC1 antibody was raised in Rabbit using Human GIPC1 as the immunogen</p>

<p>The GRP78 antibody is a specialized antibody that plays a crucial role in various biological processes. It contains unique sugar moieties, including EGF-like domains, which contribute to its functionality. This antibody has been found to possess hyaluronidase activity, making it capable of breaking down hyaluronic acid in the extracellular matrix. Additionally, the GRP78 antibody has neutralizing properties against specific targets, making it an essential tool in research and diagnostics.</p>

<p>Rabbit Polyclonal CD122 antibody (Tyr364)</p>

<p>CHRNB2 antibody was raised in rabbit using the N terminal of CHRNB2 as the immunogen</p>

<p>PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM</p>

<p>TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD</p>

<p>HNRPUL1 antibody was raised using the C terminal of HNRPUL1 corresponding to a region with amino acids LDADDEPGRPGHINEEAELQPATLQPGRLQPGLHSPTASTSTTTCLQLWE</p>

<p>The Cytokeratin 18 antibody is a diagnostic agent used in the field of Life Sciences. It is an inhibitory compound that specifically targets mesenchymal stem cells. This monoclonal antibody binds to cytokeratin 18, a protein found in the cytoplasm of epithelial cells. By targeting this protein, the antibody can be used to identify and isolate mesenchymal stem cells from other cell types. Additionally, the Cytokeratin 18 antibody can be used to detect cleavage products of cytokeratin 18 in blood plasma, which may serve as biomarkers for certain diseases or conditions. Its high specificity and affinity make it a valuable tool for researchers and clinicians working in various fields such as cancer research and regenerative medicine.</p>

<p>PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG</p>

<p>The BAD antibody is a cholinergic plasticizer used in Life Sciences. It is an antibody that specifically binds to the antigen binding domain of BAD, a protein involved in regulating cell survival and apoptosis. This antibody has been shown to inhibit the formation of syncytia, which are multinucleated cells formed by the fusion of multiple cells. Additionally, it has been demonstrated to have an effect on nuclear localization and tyrosine phosphorylation of BAD. The BAD antibody is commonly used in research and can be paired with other antibodies such as interleukin-6 or dopamine antibodies for various applications in biomolecular studies. Whether you're conducting experiments or studying cellular processes, this high-quality monoclonal antibody is an essential tool for your research needs.</p>

<p>Rabbit polyclonal SDHC antibody</p>

<p>CNTFR antibody was raised in Rabbit using Human CNTFR as the immunogen</p>

<p>Mouse monoclonal p19INK4d antibody</p>

<p>The MMP3 antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of matrix metalloproteinase 3 (MMP3). This antibody is designed to specifically bind to the histidine region of MMP3, inhibiting its function and preventing it from degrading extracellular matrix components such as collagen. By blocking the activity of MMP3, this antibody helps maintain the integrity of tissues and prevents excessive tissue remodeling.</p>

<p>CD166 antibody was raised in Mouse using a purified recombinant fragment of CD166(aa405-524) expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal Giardia intestinalis antibody</p>

<p>The TPP1 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the histidine residue of the TPP1 protein and has been shown to have neutralizing effects on its activity. The antibody binds to the polymorphic region of TPP1, preventing it from interacting with other proteins and affecting various cellular processes. This colloidal antibody can be used for quantitation purposes in experiments involving antigen-antibody reactions. Additionally, monoclonal antibodies derived from the TPP1 antibody have been developed for specific applications, such as detecting TPP1 levels in human serum or studying its role in adipose tissue.</p>

<p>Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV</p>

<p>Rabbit polyclonal PTPN5 antibody</p>

<p>Factor XIII Subunit A antibody was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.</p>

<p>The Hemoglobin antibody is a powerful tool used in Life Sciences research. It specifically targets nuclear and epidermal growth factors, which play crucial roles in various biological processes. This antibody has been extensively studied for its potential applications in treating thrombocytopenia and blocking the activity of tumor necrosis factor-α (TNF-α), a potent pro-inflammatory cytokine. Additionally, it has shown cytotoxic effects against cancer cells by inhibiting the growth factors that promote their survival and proliferation. The Hemoglobin antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its versatility makes it an invaluable asset in studying cell signaling pathways and developing targeted therapies.</p>

The RHOA antibody is a highly specialized biomolecule used in Life Sciences research. It specifically targets and binds to the activated form of RHOA, a small GTPase protein involved in various cellular processes. The antibody has been extensively studied and validated for its effectiveness in detecting RHOA activation.

<p>The DKK3 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic and growth inhibitory properties. It functions by targeting and neutralizing the activity of DKK3, a phosphatase and growth factor involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the proliferation of cancer cells.</p>

<p>IP6K1 antibody was raised in Rabbit using Human IP6K1 as the immunogen</p>

<p>GYPA antibody was raised in Rabbit using Human GYPA as the immunogen</p>

<p>Rabbit polyclonal SLC4A8 antibody</p>

<p>Rabbit polyclonal SPTBN1 antibody</p>

<p>FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK</p>

<p>G22P1 antibody was raised using the N terminal Of G22P1 corresponding to a region with amino acids  NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL</p>

<p>GSTCD antibody was raised in Rabbit using Human GSTCD as the immunogen</p>

<p>Rabbit Polyclonal PKC theta antibody (Ser676)</p>

<p>The BMP10 antibody is a highly specialized monoclonal antibody that targets mesothelin, a protein expressed in various cancers such as pancreatic, ovarian, and lung cancer. This antibody has been shown to inhibit the growth of amyloid plaques associated with Alzheimer's disease and reduce the expression of osteopontin, a protein involved in tumor progression. The BMP10 antibody can be used in various life science research applications, including immunohistochemistry, western blotting, and flow cytometry. It has also been shown to modulate the activity of β-catenin and oncostatin M signaling pathways. With its high specificity and affinity for mesothelin, this antibody is a valuable tool for studying cancer biology and developing targeted therapies.</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>Purified Polyclonal Kir3.4 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and serves as one of the most effective compounds in treating this disease. The mechanism of action involves binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication, ultimately leading to bacterial growth inhibition. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Rabbit polyclonal RGS10 antibody</p>

<p>GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK</p>

<p>The Claudin 4 antibody is a monoclonal antibody that specifically targets and inhibits the activity of Claudin 4. Claudin 4 is an important protein involved in cell adhesion and tight junction formation. This antibody has been shown to have neutralizing effects on the function of Claudin 4, preventing its interaction with other molecules such as TNF-α and chemokines.</p>

<p>MGLL antibody was raised in Rabbit using Human MGLL as the immunogen</p>

<p>ART5 antibody was raised in Rabbit using Human ART5 as the immunogen</p>

<p>PRR18 antibody was raised using the middle region of PRR18 corresponding to a region with amino acids LPARAAGPRRGGPASDPDAPPTAGQGRRAPPPGAQLLHGGLQVPQLSPRP</p>

<p>Purified Polyclonal MRPL32 antibody</p>

<p>ANXA8L2 antibody was raised in Rabbit using Human ANXA8L2 as the immunogen</p>

<p>EIF2AK1 antibody was raised using the N terminal of EIF2AK1 corresponding to a region with amino acids TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE</p>

<p>Rabbit polyclonal FTL antibody (biotin)</p>

The ADAM17 antibody is a reactive growth factor that is used as a diagnostic agent in the field of life sciences. It belongs to the group of polyclonal antibodies and is specifically designed to target chemokines, collagen, and other proteins. This antibody can detect autoantibodies and has a high affinity for galectin-3-binding and interleukin-6. Its aliphatic hydrocarbon structure allows it to effectively bind to its target molecules, making it an essential tool in various research applications. Whether you're studying protein interactions or investigating disease mechanisms, the ADAM17 antibody provides accurate and reliable results.

<p>The Actin antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets actin filaments, which are essential components of the cytoskeleton. This antibody has been extensively used in research to study the structure and function of actin filaments, as well as their role in various cellular processes.</p>

<p>The L1CAM antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is produced by hybridoma cells and is designed to specifically target L1 cell adhesion molecule (L1CAM). This antibody plays a crucial role in various biological processes, including cell migration, adhesion, and differentiation.</p>

<p>NECAP2 antibody was raised in Rabbit using Human NECAP2 as the immunogen</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>BTD antibody was raised in Rabbit using Human BTD as the immunogen</p>

<p>NCAPD3/hCAP-D3 Monoclonal Antibody</p>

<p>The GPRC5A antibody is a monoclonal antibody widely used in Life Sciences research. It is specifically designed to target GPRC5A, a protein that plays a crucial role in various cellular processes. This antibody has been shown to have neutralizing effects on GPRC5A, making it an excellent tool for studying the function and regulation of this protein.</p>

<p>Affinity purified Rabbit polyclonal NGF beta antibody</p>

<p>The SIGLEC9 antibody is a highly specialized monoclonal antibody that targets and inhibits the growth factor protein known as VEGF (vascular endothelial growth factor). This antibody has antiangiogenic properties, meaning it prevents the formation of new blood vessels. By blocking VEGF, the SIGLEC9 antibody hinders the growth and spread of tumors.</p>

<p>Rabbit polyclonal DFF45 antibody</p>

<p>Mouse anti Human IgG (Fc Specific) antibody was raised in Mouse using purified fusion protein with human IgG(Fc Specific) tag as the immunogen.</p>

<p>Rabbit polyclonal EpoR antibody (Tyr368)</p>

<p>Interdigitating cell antibody was raised in mouse using rat peritoneal macrophages as the immunogen.</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>Mouse monoclonal SSX2 antibody</p>

<p>Rabbit polyclonal POLE3 antibody</p>

<p>Rabbit polyclonal SOD1 antibody (FITC)</p>

<p>MED6 antibody was raised in Rabbit using Human MED6 as the immunogen</p>

C14ORF172 antibody was raised using the N terminal Of C14Orf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI

<p>HNRNPA0 antibody was raised in Rabbit using Human HNRNPA0 as the immunogen</p>

<p>FBXW9 antibody was raised in rabbit using the C terminal of FBXW9 as the immunogen</p>

<p>Mouse monoclonal HAV2C antibody</p>

<p>Rabbit polyclonal PTPRJ antibody</p>

<p>Purified Polyclonal CEBP alpha antibody</p>

<p>The Patched antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It acts as an agent and/or biocompatible polymer, which can be activated through disulfide bond formation. The nucleophilic linker group allows for the attachment of various molecules or compounds for targeted delivery. This antibody specifically targets the anti-ICOS antibodies, a human protein involved in immune regulation. The Patched antibody has high bioavailability and can be used to develop anti-idiotypic antibodies or reactive monoclonal antibodies. Additionally, it has shown affinity towards annexin A2, further expanding its potential applications in research and therapeutic settings.</p>

<p>The IL18 antibody is a reactive antibody that targets the glial fibrillary acidic protein (GFAP), which is expressed in activated glial cells. This antibody has been widely used in life sciences research to study the role of GFAP in various cellular processes. It has also been used as a diagnostic tool for detecting GFAP expression in tissues, such as brain sections with amyloid plaques. The IL18 antibody is available as a polyclonal antibody and can be used in various applications, including immunohistochemistry, western blotting, and ELISA. It offers high specificity and sensitivity, making it an ideal choice for researchers studying GFAP-related pathways or diseases.</p>

<p>The mGLUR2 antibody is a monoclonal antibody that specifically targets the metabotropic glutamate receptor 2 (mGLUR2). This receptor plays a crucial role in various physiological and pathological processes, including neuronal signaling, synaptic plasticity, and neurodegenerative diseases. The mGLUR2 antibody binds to the receptor and modulates its activity, leading to changes in cellular responses.</p>

<p>Mouse monoclonal PRMT2 antibody</p>

<p>A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP</p>

<p>Rabbit polyclonal ADCY1 antibody</p>

<p>The PDLIM2 antibody is a highly specialized monoclonal antibody that targets the phosphatase PDLIM2. It has been extensively studied for its therapeutic potential in various fields of medicine, including ketamine-induced neurotoxicity and lipoprotein lipase activation. This antibody is widely used in Life Sciences research to study the role of PDLIM2 in various cellular processes, such as epidermal growth factor signaling, histidine metabolism, growth factor regulation, chemokine production, fibrinogen binding, and TGF-beta signaling. The cytotoxic properties of this antibody make it a valuable tool for investigating the functions of PDLIM2 in different biological contexts.</p>

<p>Purified Rabbit polyclonal PMM2 antibody</p>

<p>Mouse monoclonal AIPL1 antibody</p>

<p>THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF</p>

<p>Rabbit polyclonal NDUFA1 antibody (HRP)</p>

<p>TD1 antibody was raised using the middle region of TD1 corresponding to a region with amino acids PPHPLNKQKHHPPHPSQTQKDLVPRSPQLEKSRIRLRRTLRNLGGGRGQR</p>

<p>Rabbit polyclonal COPS1 antibody (Ser454)</p>

<p>alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids  NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH</p>

The PKM2 antibody is a highly specialized antibody that is used in various applications within the field of Life Sciences. It is commonly used in research and diagnostic settings to detect and quantify the presence of PKM2, a key enzyme involved in glycolysis.

<p>FBXO9 antibody was raised using the middle region of FBXO9 corresponding to a region with amino acids PELESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICAR</p>

<p>ACO1 antibody was raised in Rabbit using Human ACO1 as the immunogen</p>

<p>The TRIM23 antibody is a powerful diagnostic tool used in the field of Life Sciences. It is a monoclonal antibody that specifically binds to peptide sequences associated with TRIM23, a protein involved in various cellular processes. This antibody can be utilized for the detection and analysis of TRIM23 in different biological samples, including human serum and amyloid plaques. Its high specificity and sensitivity make it an excellent choice for research and diagnostic applications. The TRIM23 antibody can be used in techniques such as hybridization, immunohistochemistry, and Western blotting. Whether you are studying pluripotent stem cells or investigating the IL-1 receptor pathway, this antibody is an essential tool for your experiments. With its reliable performance and compatibility with various experimental conditions, the TRIM23 antibody is a must-have for any researcher in the Life Sciences field.</p>

<p>FLJ33790 antibody was raised using the N terminal of FLJ33790 corresponding to a region with amino acids RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR</p>

<p>Purified Polyclonal IL12B antibody</p>

<p>GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD</p>

<p>GPRASP2 antibody was raised in Rabbit using Human GPRASP2 as the immunogen</p>

<p>The DLX5 antibody is a growth factor that has antiviral properties. It is commonly used in Life Sciences research as an inhibitor for various applications. This polyclonal antibody is highly specific and can be used for the detection of proteins such as CD33 and mesothelin. The DLX5 antibody has been extensively tested and validated, ensuring reliable results in experiments. It exhibits excellent performance in various assays, including immunohistochemistry, Western blotting, ELISA, and flow cytometry. The high affinity of this antibody allows for efficient binding to its target, making it a valuable tool for researchers studying different biological processes. Additionally, the DLX5 antibody is compatible with different sample types, including human serum and tissues. Its neutralizing properties make it ideal for blocking specific interactions or pathways during experiments. With its versatile applications and reliable performance, the DLX5 antibody is an essential component in many scientific studies within the field of Life Sciences.</p>

<p>Rabbit polyclonal IKK alpha antibody (Thr23)</p>

<p>Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL</p>

<p>Mouse monoclonal IFN gamma antibody (biotin)</p>

<p>MUTYH antibody was raised in Rabbit using Human MUTYH as the immunogen</p>

<p>CHRNA10 antibody was raised in Rabbit using Human CHRNA10 as the immunogen</p>

<p>Mouse monoclonal ARNTL antibody</p>

<p>ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC</p>

<p>PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS</p>

<p>YTHDF1 antibody was raised using the middle region of YTHDF1 corresponding to a region with amino acids QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA</p>

<p>Rabbit polyclonal RAMP1 antibody</p>

<p>Rabbit polyclonal Dynamin 1 antibody</p>

<p>Rabbit polyclonal PKC theta antibody</p>

AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE

<p>The hCG Beta antibody is a highly specific monoclonal antibody that targets the beta subunit of human chorionic gonadotropin (hCG). It is widely used in Life Sciences research for various applications, including immunoassays and immunohistochemistry.</p>

Rabbit polyclonal NUPL1 antibody

<p>Purified Rabbit polyclonal TISB antibody (Ser92)</p>

<p>RNF146 antibody was raised using the C terminal of RNF146 corresponding to a region with amino acids AVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRP</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, also known as Rifapentine, is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, Rifapentine inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Keratin K7 antibody was raised in mouse using Cytoskeletal proteins from cultured HeLa cells as the immunogen.</p>

<p>The RPS3 antibody is a monoclonal antibody that specifically targets the tyrosine kinase receptor. It has been shown to have cytotoxic effects when used in combination with doxorubicin, a commonly used chemotherapy drug. The RPS3 antibody works by binding to the receptor and activating downstream signaling pathways that lead to cell death. Additionally, this antibody has been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. Furthermore, the RPS3 antibody has been shown to neutralize extracellular histones, which are released during cell death and can cause tissue damage. This highly specific and potent antibody is an essential tool for researchers in the life sciences field studying growth factors and tyrosine kinase receptors. Whether you're conducting experiments or developing new therapeutics, the RPS3 antibody is a valuable asset for your research endeavors.</p>

<p>CD55 antibody was raised in rabbit using the middle region of CD55 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Lefty A antibody</p>

<p>The P53 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the P53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>IL18 antibody is a monoclonal antibody that acts as a medicament to target specific proteins in the body. It has cytotoxic properties, meaning it can destroy targeted cells or inhibit their growth. IL18 antibody specifically targets plasminogen activator receptor and alpha-fetoprotein, which are proteins involved in various biological processes. By binding to these proteins, IL18 antibody neutralizes their function and prevents them from carrying out their normal activities.</p>

<p>The TGF beta 1 antibody is a powerful tool in Life Sciences research. It specifically targets and neutralizes TGF-beta, an endonuclease that plays a crucial role in various cellular processes. This polyclonal antibody binds to the amino-terminal region of TGF-beta 1, preventing its interaction with receptors and subsequent downstream signaling events.</p>

<p>Rabbit polyclonal TUBA1 antibody</p>

MAGEC3 antibody was raised in Rabbit using Human MAGEC3 as the immunogen

<p>KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG</p>

<p>Rabbit polyclonal CHMP2A antibody (FITC)</p>

<p>Affinity purified Rabbit polyclonal DIP2B antibody</p>

<p>Rabbit polyclonal GRP78 antibody (biotin)</p>

Rabbit polyclonal VMO1 antibody

<p>Purified Polyclonal EIF5B antibody</p>

<p>The KDM5B antibody is a monoclonal antibody that targets the protein KDM5B. This protein plays a crucial role in regulating gene expression by modifying histone proteins through processes such as acetylation and phosphorylation. The KDM5B antibody specifically recognizes and binds to KDM5B, allowing for the detection and analysis of this protein in various biological samples.</p>

<p>The FOXP3 antibody is a powerful tool used in Life Sciences research. It is available in both polyclonal and monoclonal forms, making it versatile for various applications. This antibody specifically targets the FOXP3 protein, which plays a crucial role in immune regulation and T-cell function. By binding to the FOXP3 protein, this antibody can be used to study its expression levels and localization in different tissues and cell types.</p>

<p>Purified Rabbit polyclonal NKX26 antibody</p>

<p>Phosphoserine antibody was raised in mouse using phosphoserine-KLH as the immunogen.</p>

<p>Rabbit polyclonal GPR161 antibody (biotin)</p>

<p>Affinity purified Rabbit polyclonal NOVA1 antibody</p>

<p>Affinity purified Rabbit polyclonal ADP ribosylation factor 3 antibody</p>

<p>Mouse monoclonal CD104 antibody</p>

<p>The MLK3 antibody is a monoclonal antibody that specifically targets MLK3, a protein kinase involved in the regulation of cell growth and proliferation. This antibody has been shown to neutralize the activity of MLK3, inhibiting its function and preventing downstream signaling pathways. It has also been demonstrated to block the activity of phosphatases and interleukin-6, further highlighting its potential therapeutic applications. The MLK3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs. With its ability to inhibit MLK3 activation, this antibody holds promise for the development of novel treatments targeting various diseases and disorders associated with aberrant MLK3 signaling.</p>

<p>Purified Polyclonal TUBA3C antibody</p>

<p>Affinity purified Rabbit polyclonal GBP3 antibody</p>

<p>Affinity purified Rabbit polyclonal PSMB8 antibody</p>