Primary Antibodies

<p>The SEK1 antibody is a monoclonal antibody that specifically targets lipoprotein lipase. It is commonly used in research and diagnostic applications to detect and quantify the levels of lipoprotein lipase in various biological samples. Lipoprotein lipase plays a crucial role in lipid metabolism, as it hydrolyzes triglycerides from circulating lipoproteins, allowing the release of free fatty acids for energy production or storage. This antibody can also be used to study other proteins involved in lipid metabolism, such as growth hormone receptor, collagen, tyrosine kinase receptor, and phosphatase. With its high specificity and sensitivity, the SEK1 antibody is an invaluable tool for researchers and clinicians working in the field of lipid biology and related disorders.</p>

<p>PF4 antibody was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.</p>

<p>LPAR5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Purified Polyclonal CRHR1 antibody</p>

<p>Rabbit polyclonal HSP90B antibody</p>

<p>Rabbit polyclonal NFKB p105 antibody</p>

<p>GAP 43 antibody was raised in rabbit using synthetic GAP-43 (221-226) conjugated to BSA as the immunogen.</p>

<p>The Dienestrol antibody is a specialized antibody used in the field of Life Sciences. It specifically targets and interacts with fibrinogen, a cell antigen involved in blood clotting. This antibody has been extensively studied for its ability to modulate triglyceride lipase activity and inhibit lipoprotein lipase. Both polyclonal and monoclonal antibodies have been developed for this purpose. Additionally, the Dienestrol antibody has shown potential in regulating interleukin-6 levels, a key cytokine involved in inflammation. Its binding to specific regions of lipase and endothelial growth factor receptors may also contribute to its therapeutic potential. Researchers are actively exploring the use of this antibody in various applications, including autoimmune disorders and cancer research.</p>

<p>Mouse macrophage antibody was raised in rabbit using mouse macrophages as the immunogen.</p>

<p>HSV1 antibody was raised in goat using HSV type 1, strain F as the immunogen.</p>

<p>The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody plays a crucial role in various biological processes, including iron homeostasis and glycosylation. It has been shown to interact with low-density lipoproteins and reactive molecules present in human serum.</p>

<p>basic hair keratin K84 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K84 coupled to KLH as the immunogen.</p>

<p>Rabbit anti-sheep IgG (Alk Phos) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The PKR antibody is a highly specialized monoclonal antibody that targets and neutralizes the protein kinase R (PKR). This antibody is widely used in Life Sciences research to study the role of PKR in various cellular processes.</p>

<p>Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.</p>

<p>SCRT2 antibody was raised in rabbit using the middle region of SCRT2 as the immunogen</p>

<p>Turkey RBC antibody was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>Cdx1 antibody was raised in rabbit using the C terminal of Cdx1 as the immunogen</p>

<p>Goat anti-human IgG/IgA/IgM (H+L) (Alk Phos) was raised in goat using human IgG, IgA and IgM whole molecule as the immunogen.</p>

<p>Vesicular Acetylcholine Transporter antibody was raised in rabbit using synthetic peptide from the C-terminus of human VAChT conjugated to BSA as the immunogen.</p>

<p>Rabbit anti-bovine IgG (H+L) (biotin) was raised in rabbit using bovine IgG whole molecule as the immunogen.</p>

<p>Sheep polyclonal JWH 018 antibody</p>

<p>Rabbit anti-goat IgG (H + L) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>MLPH antibody was raised in rabbit using the C terminal of MLPH as the immunogen</p>

<p>STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM and light chains on all mouse immunoglobulins.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

Ractopamine antibody is a highly stable liquid formulation that contains monoclonal antibodies. It is specifically designed to detect and bind to ractopamine, a β-agonist commonly used as a feed additive in livestock production. The antibodies in this formulation are produced by hybridoma cells, ensuring high specificity and sensitivity. Ractopamine antibody can be used in various applications, including chromatographic assays, immunoassays, and electrode-based detection methods. This product is widely used in the Life Sciences field for research purposes and can also be utilized in the development of diagnostic kits or medicaments targeting ractopamine residues. Its ability to selectively bind to ractopamine makes it an essential tool for detecting this compound in various samples, including animal tissues, urine, or feed. With its reliable performance and ease of use, Ractopamine antibody provides researchers with a valuable tool for accurate analysis and monitoring of ractopamine levels.

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes.</p>

KEAP1 antibody was raised in rabbit using the C terminal of KEAP1 as the immunogen

<p>The GATA1 antibody is a polyclonal antibody that specifically targets the GATA1 protein, which plays a crucial role in the regulation of hematopoiesis and erythroid differentiation. This antibody has been extensively tested and validated for use in various life science applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>HTR1B antibody was raised in rabbit using the N terminal of HTR1B as the immunogen</p>

<p>Serotonin antibody was raised in rabbit using serotonin/ovalbumin as the immunogen.</p>

<p>Rabbit anti-rat IgG (H+L) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>PLD2 antibody was raised in rabbit using the middle region of PLD2 as the immunogen</p>

<p>The NEFM antibody is a monoclonal antibody that belongs to the chemokine family of antibodies. It acts as a kinase inhibitor and is widely used in Life Sciences research. This antibody specifically targets tumor necrosis factor-alpha (TNF-α), which is a key player in inflammatory responses. By neutralizing TNF-α, the NEFM antibody helps reduce inflammation and its associated symptoms.</p>

<p>Goat anti-rat IgG (H+L) (FITC) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP</p>

<p>Purified Polyclonal CDKL2 antibody</p>

<p>This antibody reacts with heavy (mu) chains on human IgM.</p>

<p>The HDAC5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets atypical hemolytic autoantibodies. This antibody has neutralizing properties, meaning it can inhibit the activity of these autoantibodies, preventing them from causing damage to red blood cells. The HDAC5 antibody is produced using state-of-the-art techniques and has been extensively tested for its efficacy and specificity.</p>

Protein C antibody was raised in goat using human Protein C purified from plasma as the immunogen.

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>GABRD antibody was raised in rabbit using the N terminal of GABRD as the immunogen</p>

<p>Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal FBXL4 antibody</p>

<p>RSV antibody was raised in goat using human RSV isolate as the immunogen.</p>

<p>CCDC16 antibody was raised in rabbit using the middle region of CCDC16 as the immunogen</p>

<p>Goat anti-human IgG (H+L) (HRP) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Donkey anti-rabbit IgG (H + L) (rhodamine) was raised in donkey using rabbit IgG (H&amp;L) as the immunogen.</p>

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

<p>Chicken anti Mouse IgG secondary antibody (FITC)</p>

<p>BCL2L1 antibody was raised in rabbit using the N terminal of BCL2L1 as the immunogen</p>

<p>Rabbit anti-chicken IgG (H+L) (biotin) was raised in rabbit using chicken IgG whole molecule as the immunogen.</p>

Sheep polyclonal Oxazepam antibody

<p>The Estrogen Receptor alpha antibody is a highly reactive antibody that specifically targets the estrogen receptor alpha. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to be effective in detecting amyloid plaques, which are associated with neurodegenerative diseases such as Alzheimer's. Additionally, this antibody can also be used to study protein kinase activation and is commonly used in research involving antibodies.</p>

<p>Rabbit polyclonal alpha Internexin antibody</p>

<p>The Ezrin antibody is a trifunctional monoclonal antibody that targets the protein ezrin. This antibody has phosphatase activity and can inhibit the activation of ezrin, which is involved in cell signaling pathways. It has been shown to be effective in reducing the levels of alpha-fetoprotein, a tumor marker, in human serum. The Ezrin antibody can also be used for various research applications, such as immunohistochemistry and Western blotting. Additionally, it has been used in electrode-based assays to detect chemokines, autoantibodies, growth factors, fibrinogen, and protein kinases. With its versatility and specificity, the Ezrin antibody is a valuable tool for studying cellular processes and investigating disease mechanisms.</p>

<p>The HSP27 antibody is a highly specific monoclonal antibody that targets human serum proteins. It is designed to immobilize circovirus and fibrinogen, preventing their interaction and potential harm. This antibody has been extensively tested and proven effective in neutralizing the activity of circovirus, making it an essential tool in the field of Life Sciences. Additionally, the HSP27 antibody has demonstrated reactivity against other targets such as carbamazepine and mesenchymal stem cells, further expanding its potential applications. With its high specificity and reliability, this monoclonal antibody is a valuable asset for researchers and scientists working in various fields.</p>

KLHL5 antibody was raised in rabbit using the N terminal of KLHL5 as the immunogen

<p>Rabbit anti-dog IgG was raised in rabbit using canine IgG F(ab')2 fragment as the immunogen.</p>

<p>CASP1 antibody was raised in rabbit using the middle region of CASP1 as the immunogen</p>

<p>Goat anti Chicken IgY secondary antibody (Biotin)</p>

<p>LYSMD4 antibody was raised using the N terminal of LYSMD4 corresponding to a region with amino acids PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD</p>

<p>The c-Jun antibody is a powerful tool used in life sciences research to study various cellular processes. It specifically targets c-Jun, a protein that plays a crucial role in cell growth and differentiation. This antibody can be used for quantitation and detection of c-Jun in different samples, including human serum and adipose tissue. It is available both as polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Rabbit polyclonal Zap 70 antibody</p>

<p>CHRNA3 antibody was raised in rabbit using the N terminal of CHRNA3 as the immunogen</p>

<p>IgA antibody was raised in Mouse using recombinant human IgA2 as the immunogen.</p>

<p>Morphine antibody was raised in mouse using Morphine-3-BSA as the immunogen.</p>

<p>SFRP1 antibody was raised in rabbit using the middle region of SFRP1 as the immunogen</p>

<p>The Connexin 43 antibody is a glycoprotein that plays a crucial role in various biological processes. It is commonly used in research and clinical settings to study thrombotic thrombocytopenic purpura, microvessel density, and spleen ferritin levels. This polyclonal antibody specifically targets Connexin 43, which is an important protein involved in cell communication and growth regulation.</p>

<p>Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The Estrogen Receptor alpha antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the estrogen receptor alpha, a protein complex involved in various cellular processes. This antibody has been extensively tested and validated for its high affinity and specificity.</p>

<p>This antibody reacts with heavy chains on cat IgG and light chains on all cat immunoglobulins.</p>

<p>The MKK6 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It specifically targets the activated form of MKK6, a key enzyme involved in the natriuretic signaling pathway. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting MKK6 activation in various experimental settings.</p>

<p>IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.</p>

<p>Rabbit polyclonal cdc25A antibody</p>

<p>Goat anti-cat IgG (H+L) (Alk Phos) was raised in goat using feline IgG whole molecule as the immunogen.</p>

<p>The Tyrosine Hydroxylase antibody is a highly specialized monoclonal antibody that targets the enzyme responsible for the conversion of L-tyrosine to L-dihydroxyphenylalanine (L-DOPA), a precursor for dopamine synthesis. This antibody has been extensively tested and validated for use in various research applications, including neuroscience, endocrinology, and immunohistochemistry.</p>

<p>Goat anti Monkey IgG (H + L) secondary antibody (HRP)</p>

<p>PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen</p>

<p>CYP1A2 antibody was raised in rabbit using a synthetic peptide as the immunogen.</p>

<p>The CDC2 antibody is a highly specialized antibody that has multiple applications in the field of biomedical research. It is a polyclonal antibody that can be used for various purposes, such as immunohistochemistry and Western blotting. The CDC2 antibody specifically targets the CDC2 protein, which plays a crucial role in cell division and proliferation.</p>

<p>The CLAD antibody is a monoclonal antibody that specifically binds to tyrosine kinase receptor-associated protein (CLAD), which is involved in various cellular processes. This antibody has been shown to inhibit the binding of glucagon to its receptor and interfere with downstream signaling pathways. Additionally, it has been demonstrated to modulate the activity of phosphatases and dopamine receptors, leading to cytotoxic effects on target cells. The CLAD antibody can also interact with carbonyl reductase and other binding proteins, further enhancing its therapeutic potential. With its ability to target specific antigens, this antibody holds promise in the field of Life Sciences and may have applications in the treatment of diseases such as cancer and autoimmune disorders.</p>

<p>Rabbit polyclonal PLCG1 antibody</p>

<p>acidic hair keratin K34 antibody was raised in Guinea Pig using synthetic peptide of human acidic hair (trichocytic) keratin K34 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal Coflin 1 and Cofilin 2 antibody</p>

IgG antibody was raised in Mouse using A fusion protein containing human IgG Fc as the immunogen.

<p>Glicentin/Glucagon antibody was raised in rabbit using Porcine pancreatic glucagon /BSA as the immunogen.</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>TrkC antibody was raised in goat using the entire extracellular domain of rat TrkC receptor as the immunogen.</p>

<p>Sheep polyclonal Virginiamycin antibody</p>

HSFY1 antibody was raised in rabbit using the N terminal of HSFY1 as the immunogen

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>Goat anti-rat IgG (H+L) (Alk Phos) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.</p>

<p>Sheep polyclonal Hydromorphone antibody</p>

<p>Goat anti-Bovine IgG (H + L) (Alk Phos) was raised in goat using purified Bovine IgG (H&amp;L) as the immunogen.</p>

Goat anti-human IgM (Fab'2) (HRP) was raised in goat using human IgM Fc5mu fragment as the immunogen.

<p>PIBF1 antibody was raised in rabbit using the C terminal of PIBF1 as the immunogen</p>

The MEF2A antibody is a monoclonal antibody that targets the nuclear protein MEF2A. It plays a crucial role in endothelial growth and fibronectin production, making it a valuable tool in Life Sciences research. This antibody can be used as a medicament to treat various conditions related to protein dysregulation. Additionally, it can be used in immunohistochemistry studies to detect the expression of MEF2A in different tissues. The MEF2A antibody is also useful for studying the interaction between MEF2A and other proteins, such as human chorionic gonadotropin (hCG) and vascular endothelial growth factor-C (VEGF-C). With its high specificity and sensitivity, this antibody is an essential tool for researchers working in the field of collagen biology and angiogenesis.

<p>Keratin K81-K86 antibody was raised in Guinea Pig using synthetic peptide common to human type II (basic) hair (trichocytic) keratins K81-K86 coupled to KLH as the immunogen.</p>

<p>AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PCSK6 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ZNF606 antibody was raised in rabbit using the N terminal of ZNF606 as the immunogen</p>

<p>VEZF1 antibody was raised in rabbit using the middle region of VEZF1 as the immunogen</p>

<p>The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in various cellular processes, including cell growth and proliferation. The EGFR antibody is widely used in Life Sciences research to study the function and regulation of EGFR.</p>

<p>The VASP antibody is a highly effective tool used in life sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody specifically targets the vasodilator-stimulated phosphoprotein (VASP), which plays a crucial role in cell signaling pathways. The VASP antibody is widely used in various applications, including immunofluorescence, Western blotting, and immunohistochemistry.</p>

<p>Gja4 antibody was raised in rabbit using the N terminal of GJA4 as the immunogen</p>

<p>The Tau antibody is a highly specific monoclonal antibody that is used in the field of Life Sciences. It is commonly used for research purposes and has been extensively studied for its potential therapeutic applications. This antibody specifically targets Tau, a protein that plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. By binding to Tau, this antibody helps researchers understand the mechanisms underlying these diseases and develop potential treatments.</p>

<p>Factor IX antibody was raised in goat using human Factor IX purified from plasma as the immunogen.</p>

<p>Donkey anti-goat IgG (rhodamine) was raised in donkey using goat IgG (H &amp; L) as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG.</p>

<p>Rabbit polyclonal GSK3 alpha antibody</p>

This antibody reacts with heavy chains on human IgE (epsilon chain).

<p>Periostin antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in the field of life sciences. Periostin antibody has shown promising results in neutralizing chemokines and growth factors, such as alpha-fetoprotein and anti-mesothelin. This antibody can also activate specific pathways that contribute to antiviral defense mechanisms.</p>

<p>THRA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit anti-mouse lambda chain (Alk Phos) was raised in rabbit using murine lambda light chain as the immunogen.</p>

<p>GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The Shc1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor (EGF) and its receptor. It has the ability to bind to EGF-like molecules and inhibit their activity. This antibody can also neutralize the effects of EGF by preventing its binding to receptors on cells. The Shc1 antibody is highly specific and has been extensively studied in various life science research applications. It is commonly used in experiments involving growth factors, hormones, peptides, chemokines, and other signaling molecules. Additionally, this antibody has been shown to interact with human serum albumin, a major protein found in blood plasma. Its unique characteristics make it a valuable tool for researchers in the field of molecular biology and biochemistry.</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>Sheep polyclonal Spiramycin antibody</p>

<p>RAGE antibody was raised in goat using a peptide; PKKPPQRLEWKLNTGRTE, as the immunogen.</p>

<p>The PKC zeta antibody is a highly specialized monoclonal antibody that is used for ultrasensitive detection in various immunoassays. It specifically targets and binds to protein kinase C zeta (PKCζ), an enzyme involved in signal transduction pathways. This antibody has been extensively validated and proven to provide accurate and reliable results in research and diagnostic applications.</p>

<p>Apbb1 antibody was raised in rabbit using the N terminal of Apbb1 as the immunogen</p>

<p>GPR15 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Aurora B Antibody is a growth factor that belongs to the class of antibodies. It interacts with calmodulin and plays a crucial role in various cellular processes. This antibody has been shown to be reactive and activated in adipose tissue. It is buffered to maintain stability and effectiveness. The Aurora B Antibody is also neutralizing, meaning it can block the activity of certain proteins or molecules. It is commonly used in Life Sciences research for its immunosuppressant properties. Additionally, this antibody has been found to inhibit the activity of 3-kinase, which is involved in cell signaling pathways. It does not have any diuretic effects or interact with influenza hemagglutinin.</p>

<p>CLDN2 antibody was raised in rabbit using the N terminal of CLDN2 as the immunogen</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>The RELB antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been extensively studied and proven to be effective in neutralizing the activity of RELB, a protein involved in multiple cellular functions.</p>

CYP2C11 antibody was raised in rabbit using Synthetic peptides corresponding to residues D(49) I G Q S I K K F S K V(60) and Q(491) R A D S L S S H L(500) of rat Cytochrome P450 2C11 as the immunogen.

<p>MDC1 antibody was raised in rabbit using the C terminal of MDC1 as the immunogen</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Phencyclidine antibody is a highly specialized inhibitor that targets the growth factor and acts as an anti-connexin agent. It is commonly used in Life Sciences, specifically in research related to helicobacter and chemokine. This antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The colloidal microsphere formulation ensures efficient binding to the target molecules, enhancing the accuracy of experimental results. Additionally, this antibody has demonstrated efficacy in inhibiting telomerase activity and phosphorylcholine signaling pathways. Researchers can also utilize this antibody as a substrate for siRNA delivery or as an endothelial growth factor in cell culture studies. With its wide range of applications, the Phencyclidine antibody is a valuable tool for researchers in various fields of study.</p>

<p>Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids  PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS</p>

<p>Goat anti-rat IgG (Fab'2) (HRP) was raised in goat using Rat IgG F(c) whole molecule as the immunogen.</p>

<p>ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rabbit polyclonal NR2C1 antibody</p>

<p>The MyoD antibody is a powerful tool used in immunoassays and bioassays for the detection and quantification of MyoD, a transcription factor involved in muscle development. This antibody can be used in various applications, including electrochemical impedance spectroscopy, where it enables the measurement of changes in impedance caused by the antigen-antibody reaction. The MyoD antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. It has been extensively validated for its specificity and sensitivity in detecting MyoD in different sample types.</p>

Sheep polyclonal Tramadol 3 antibody

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen</p>

<p>The Paxillin antibody is a polyclonal antibody that is commonly used in Life Sciences research. It specifically targets the protein paxillin, which plays a crucial role in cell adhesion and migration. This antibody can be used for various applications, including immunofluorescence, Western blotting, and immunohistochemistry.</p>

<p>ZNF682 antibody was raised in rabbit using the N terminal of ZNF682 as the immunogen</p>

<p>Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.</p>

<p>Rabbit polyclonal cdc25A antibody</p>

<p>HMG1L10 antibody was raised in rabbit using the C terminal of HMG1L10 as the immunogen</p>

<p>Rabbit polyclonal SAPK/JNK antibody</p>

<p>The Estriol antibody is a specific antibody used in Life Sciences research. It is commonly used to detect and measure the levels of estriol, a hormone produced during pregnancy. This antibody can be used in various applications such as immunohistochemistry, western blotting, and ELISA assays. The Estriol antibody has been shown to have high affinity and specificity for estriol, making it a reliable tool for researchers studying hormone regulation. Additionally, this antibody has been used in studies investigating the role of estriol in dopamine signaling, liver microsomes, leukemia inhibitory factor (LIF), interleukin-6 (IL-6), β-catenin inhibitors, oncostatin, and protein kinase pathways. With its versatility and accuracy, the Estriol antibody is an essential tool for scientists conducting hormonal research.</p>

<p>The p53 antibody is a highly specialized monoclonal antibody designed to target and bind to the p53 protein. This protein plays a crucial role in regulating cell growth and preventing the formation of tumors. The p53 antibody is widely used in research and diagnostic applications, as it allows scientists to study the expression and function of p53 in various biological samples.</p>

<p>Rabbit anti-rat IgG (Alk Phos) was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>The Pax5 antibody is a highly effective monoclonal antibody that targets mesothelin, a protein associated with various cancers. It is widely used in Life Sciences research and has been shown to inhibit the growth of cancer cells by blocking the oncostatin signaling pathway. This antibody specifically binds to mesothelin and prevents its interaction with other proteins, thereby inhibiting tumor growth. Additionally, the Pax5 antibody has been used in studies to detect serum albumin protein and osteopontin levels in cancer patients. It has also been shown to enhance the effects of chemotherapy drugs like taxol by increasing their efficacy against cancer cells. Furthermore, this antibody has potential applications in Alzheimer's disease research as it can bind to amyloid plaques and reduce glutamate-induced neurotoxicity. The Pax5 antibody has also been found to modulate cellular signaling pathways by activating β-catenin and promoting e-cadherin expression. Overall, this high-quality monoclonal antibody offers great promise for both diagnostic</p>

<p>Sheep polyclonal Boldenone antibody</p>

<p>GPR32 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal NFKB p105 antibody</p>

<p>Goat anti-bovine IgG was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.</p>

<p>RAB3A antibody was raised in rabbit using the C terminal of RAB3A as the immunogen</p>

<p>RBM18 antibody was raised in rabbit using the middle region of RBM18 as the immunogen</p>

<p>Human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>

<p>The c-Jun antibody is a powerful tool for researchers in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing options for various experimental needs. This antibody specifically targets c-Jun, a protein involved in cellular growth and development. It has been extensively studied in relation to helicobacter infection, collagen synthesis, phosphorylcholine signaling, telomerase activity, and endothelial growth factor regulation.</p>

<p>The PROX1 antibody is a powerful tool for researchers studying growth factors and inhibitors. Antibodies are essential binding proteins that recognize specific biomolecules, allowing researchers to study their functions and interactions. This particular antibody specifically targets PROX1, a transcription factor involved in various cellular processes.</p>

<p>Nup153 Antibody</p>

<p>Cathepsin H antibody was raised in rabbit using cathepsin H (human Liver) as the immunogen.</p>

<p>Complement C6 antibody was raised in goat using highly purified human complement protein as the immunogen.</p>