Primary Antibodies

<p>Rabbit polyclonal PLCG1 antibody</p>

<p>TTC19 antibody was raised in rabbit using the N terminal of TTC19 as the immunogen</p>

<p>The MKK6 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to MKK6, which is a tyrosine kinase-like enzyme involved in various cellular processes. This antibody is widely used in research and diagnostics for its ability to detect and measure the levels of MKK6 in biological samples.</p>

<p>The LIN28B antibody is a specific monoclonal antibody that has been developed for the detection and study of LIN28B protein. It is widely used in research and diagnostic applications. The LIN28B antibody has high affinity and specificity for its target, allowing for accurate and reliable results. Its disulfide bond structure ensures stability and durability.</p>

<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

The Streptavidin antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets annexin A2, an important protein involved in various cellular processes. By binding to annexin A2, the Streptavidin antibody enables researchers to study and manipulate its functions in both normal and disease conditions.

<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>

<p>The Histone H3.1 antibody is a highly effective antiviral agent that targets autoantibodies and interleukins in the body. It has been proven to have a high-flux capability, making it an ideal choice for treating various viral infections. This antibody works by interacting with cation channels and methyl transferase enzymes, effectively inhibiting their activity and preventing viral replication. The Histone H3.1 antibody is available in both monoclonal and polyclonal forms, allowing for personalized treatment options based on individual patient needs. Additionally, this antibody has shown promising results as a biomarker composition in the field of nuclear medicine, making it a valuable tool for diagnostic purposes.</p>

The Methamphetamine antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the effects of methamphetamine in the body. This antibody has been extensively studied and has shown promising results in various preclinical and clinical trials.

This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.

<p>The Adiponectin antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to specifically target and bind to adiponectin, a protein hormone involved in various physiological processes. This antibody is commonly used as a test substance in research studies and diagnostic assays to measure the levels of adiponectin in human serum or blood plasma.</p>

<p>Met antibody is an anti-HER2 antibody that belongs to the class of antibodies and inhibitors. It specifically targets β-catenin and inhibits its activity, thereby suppressing the growth and proliferation of cancer cells. Met antibody also inhibits the activity of VEGF-C, a protein involved in endothelial growth and angiogenesis. This antibody has been shown to have synergistic effects when used in combination with trastuzumab, another HER2-targeted therapy. Additionally, Met antibody has been found to interact with fibronectin and collagen, two components of the extracellular matrix, suggesting a potential role in modulating cell adhesion and migration. In life sciences research, Met antibody is commonly used as a tool to study the function of the MET receptor and its downstream signaling pathways.</p>

Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Rabbit polyclonal HDAC4+5+9 antibody</p>

<p>PA2G4 antibody was raised in rabbit using the middle region of PA2G4 as the immunogen</p>

<p>The p70S6 Kinase antibody is a highly specialized monoclonal antibody that targets the disulfide bond of the p70S6 kinase protein. This antibody has been extensively tested and proven to be cytotoxic, leading to the lysis of cells expressing high levels of p70S6 kinase. It has also been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and cell death.</p>

<p>The HSF1 antibody is a highly specialized antibody that targets the heat shock factor 1 (HSF1) protein. This protein plays a crucial role in cellular stress response and regulation of gene expression. The HSF1 antibody is designed to specifically bind to HSF1, neutralizing its activity and preventing it from activating stress response genes.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rabbit polyclonal Stathmin 1 antibody</p>

<p>Rabbit anti-bovine IgG (HRP) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research to study catecholaminergic neurons. This antibody specifically targets and detects tyrosine hydroxylase, the key enzyme involved in dopamine synthesis. By binding to tyrosine hydroxylase, this antibody allows researchers to visualize and study the distribution and activity of dopaminergic neurons in various tissues and cell cultures.</p>

<p>Acp2 antibody was raised in rabbit using the middle region of Acp2 as the immunogen</p>

<p>MUC3B antibody was raised using the middle region of MUC3B corresponding to a region with amino acids KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA</p>

<p>A4GNT antibody was raised using the N terminal of A4GNT corresponding to a region with amino acids LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME</p>

<p>HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT</p>

<p>Slc26a2 antibody was raised in rabbit using the C terminal of Slc26a2 as the immunogen</p>

<p>Purified Polyclonal USP32 antibody</p>

<p>PHF20L1 antibody was raised in rabbit using the N terminal of PHF20L1 as the immunogen</p>

<p>C14ORF180 antibody was raised using the N terminal Of C14Orf180 corresponding to a region with amino acids RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS</p>

<p>The TAU antibody is a highly specialized molecule drug that belongs to the class of monoclonal antibodies. It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. This antibody specifically targets and binds to TAU protein, which is involved in various cellular processes such as insulin signaling, anti-VEGF activity, protein kinase regulation, and more.</p>

<p>ZMAT3 antibody was raised in rabbit using the N terminal of ZMAT3 as the immunogen</p>

<p>Cyb5r1 antibody was raised in rabbit using the N terminal of Cyb5r1 as the immunogen</p>

<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>

<p>SEMA4B antibody was raised using the N terminal of SEMA4B corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS</p>

<p>KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP</p>

<p>IKK-gamma antibody was raised in rabbit using residues 385-399 [RRSPPEEPPDFCCPK] of the IKK-gamma protein as the immunogen.</p>

<p>Neuroserpin antibody was raised in rabbit using highly pure recombinant human neuroserpin as the immunogen.</p>

<p>SERPINB13 antibody was raised in rabbit using the middle region of SERPINB13 as the immunogen</p>

<p>Monopolin antibody was raised in rabbit using protein from Saccharomyce cerevisiae as the immunogen.</p>

<p>PSCA antibody was raised in rabbit using the C terminal of PSCA as the immunogen</p>

<p>TMEM132B antibody was raised using the middle region of TMEM132B corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK</p>

<p>HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen</p>

<p>Mouse monoclonal Tn antigen antibody (Prediluted for IHC)</p>

<p>GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS</p>

<p>Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids DPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQV</p>

<p>ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL</p>

<p>PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.</p>

<p>GFAP antibody was raised in rabbit using the N terminal of Gfap as the immunogen</p>

<p>Cyb5r2 antibody was raised in rabbit using the C terminal of Cyb5r2 as the immunogen</p>

<p>IL15 antibody was raised in rabbit using highly pure recombinant murine IL-15 as the immunogen.</p>

<p>The Beta Amyloid antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody is specifically designed to target and bind to beta amyloid, a protein that plays a crucial role in the development and progression of Alzheimer's disease. By binding to beta amyloid, this antibody inhibits its aggregation and promotes its clearance from the brain.</p>

<p>KSHV ORF8 antibody was raised in rabbit using a synthetic peptide corresponding to the amino acid sequence of KSHV ORF8  as the immunogen.</p>

<p>TIMP3 antibody was raised in rabbit using the middle region of TIMP3 as the immunogen</p>

<p>CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW</p>

<p>FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD</p>

<p>RAP1GAP antibody was raised in rabbit using the middle region of RAP1GAP as the immunogen</p>

<p>BCL11A antibody was raised in rabbit using the C terminal of BCL11A as the immunogen</p>

<p>Purified Polyclonal PIK3R1 antibody</p>

<p>CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV</p>

<p>SRFBP1 antibody was raised in rabbit using the N terminal of SRFBP1 as the immunogen</p>

<p>Polg antibody was raised in rabbit using the N terminal of Polg as the immunogen</p>

<p>RSV antibody was raised in rabbit using Residues 81-95 [LESYIGSINNITKQSA] of the human RSV M2 protein as the immunogen.</p>

<p>IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA</p>

<p>UPF2 antibody was raised in rabbit using the N terminal of UPF2 as the immunogen</p>

<p>HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL</p>

<p>ZFYVE28 antibody was raised in rabbit using the N terminal of ZFYVE28 as the immunogen</p>

<p>SLC22A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR</p>

<p>ARHGEF2 antibody was raised in rabbit using the C terminal of ARHGEF2 as the immunogen</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV</p>

<p>RHEBL1 antibody was raised using the middle region of RHEBL1 corresponding to a region with amino acids TRVPVVLVGNKADLSPEREVQAVEGKKLAESWGATFMESSARENQLTQGI</p>

<p>SLC25A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT</p>

<p>Cyyr1 antibody was raised in rabbit using the middle region of Cyyr1 as the immunogen</p>

<p>INTS4 antibody was raised in rabbit using the middle region of INTS4 as the immunogen</p>

<p>COX18 antibody was raised in rabbit using the middle region of COX18 as the immunogen</p>

<p>Med19 antibody was raised in rabbit using the N terminal of Med19 as the immunogen</p>

<p>Purified Polyclonal Lamin A/C antibody</p>

<p>XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS</p>

<p>KCNK10 antibody was raised using the N terminal of KCNK10 corresponding to a region with amino acids EKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSA</p>

<p>GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE</p>

<p>C19orf25 antibody was raised in rabbit using the n terminal of C19ORF25 as the immunogen</p>

<p>RHOD antibody was raised using the C terminal of RHOD corresponding to a region with amino acids NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG</p>

<p>Fkrp antibody was raised in rabbit using the C terminal of Fkrp as the immunogen</p>

<p>PAQR6 antibody was raised using the middle region of PAQR6 corresponding to a region with amino acids GCGQEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGEGTPGPAR</p>

<p>TRIB1 antibody was raised in rabbit using the C terminal of TRIB1 as the immunogen</p>

UMODL1 antibody was raised in rabbit using the middle region of UMODL1 as the immunogen

<p>GBA3 antibody was raised in rabbit using the N terminal of GBA3 as the immunogen</p>

<p>ATG12 antibody was raised in rabbit using the middle region of ATG12 as the immunogen</p>

<p>GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY</p>

<p>ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN</p>

<p>CNTN1 antibody was raised in rabbit using the middle region of CNTN1 as the immunogen</p>

<p>Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE</p>

<p>IRX3 antibody was raised in rabbit using the C terminal of IRX3 as the immunogen</p>

<p>FAM38B antibody was raised using the middle region of FAM38B corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS</p>

<p>CUTA antibody was raised using a synthetic peptide corresponding to a region with amino acids AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL</p>

<p>FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG</p>

<p>ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG</p>

<p>Gad1 antibody was raised in rabbit using the N terminal of Gad1 as the immunogen</p>

<p>NLRP5 antibody was raised in rabbit using the N terminal of NLRP5 as the immunogen</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>NXPH1 antibody was raised in rabbit using the N terminal of NXPH1 as the immunogen</p>

<p>GLIS3 antibody was raised in rabbit using the C terminal of GLIS3 as the immunogen</p>

<p>PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE</p>

<p>RAB25 antibody was raised in rabbit using the middle region of RAB25 as the immunogen</p>

<p>LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL</p>

<p>ZNF417 antibody was raised in rabbit using the N terminal of ZNF417 as the immunogen</p>

<p>CYP21A2 antibody was raised in rabbit using the C terminal of CYP21A2 as the immunogen</p>

<p>The S6K1 antibody is a highly specialized monoclonal antibody that targets collagen, a crucial protein in various biological processes. This antibody is designed to specifically bind to collagen at low pH levels, making it suitable for a wide range of applications. It is a glycoprotein that can be used in research and diagnostic settings.</p>

<p>KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK</p>

<p>GDF3 antibody was raised in rabbit using highly pure recombinant human GDF-3 as the immunogen.</p>

<p>CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI</p>

<p>Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV</p>

<p>Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.</p>

<p>GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE</p>

<p>LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL</p>

<p>Pygm antibody was raised in rabbit using the C terminal of Pygm as the immunogen</p>

<p>SERPINB6 antibody was raised in rabbit using the middle region of SERPINB6 as the immunogen</p>

<p>LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK</p>

<p>ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV</p>

<p>DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogen</p>

<p>Rabbit polyclonal MPO antibody (Prediluted for IHC)</p>

<p>PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW</p>

<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>

<p>ZNF414 antibody was raised in rabbit using the N terminal of ZNF414 as the immunogen</p>

<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>

<p>SLC39A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA</p>

<p>ZNF404 antibody was raised in rabbit using the middle region of ZNF404 as the immunogen</p>

<p>SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY</p>

<p>ACVR2B antibody was raised using the C terminal of ACVR2B corresponding to a region with amino acids HDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI</p>

<p>PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN</p>

<p>APC2 antibody was raised in rabbit using the middle region of APC2 as the immunogen</p>

<p>PAI1 antibody was raised in rabbit using highly pure recombinant human PAI-1 as the immunogen.</p>

<p>KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA</p>

<p>REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE</p>

<p>ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogen</p>

<p>LRRFIP2 antibody was raised in rabbit using the N terminal of LRRFIP2 as the immunogen</p>

<p>RAB9A antibody was raised in rabbit using the middle region of RAB9A as the immunogen</p>

<p>SGPP1 antibody was raised in rabbit using the middle region of SGPP1 as the immunogen</p>

<p>BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE</p>

<p>Rabbit polyclonal Desmin antibody (Prediluted for IHC)</p>

<p>ELMO1 antibody was raised in rabbit using the C terminal of ELMO1 as the immunogen</p>

<p>GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA</p>

<p>ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY</p>

<p>SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA</p>

<p>Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND</p>

<p>TAF9 antibody was raised in rabbit using the N terminal of TAF9 as the immunogen</p>

<p>PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS</p>

<p>DNAJC19 antibody was raised in rabbit using the C terminal of DNAJC19 as the immunogen</p>

<p>Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP</p>

<p>ZHX3 antibody was raised in rabbit using the middle region of ZHX3 as the immunogen</p>

<p>OPRL1 antibody was raised in rabbit using the middle region of OPRL1 as the immunogen</p>

<p>MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE</p>

<p>POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC</p>

<p>Wdr8 antibody was raised in rabbit using the N terminal of Wdr8 as the immunogen</p>

<p>GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY</p>

<p>SIN3B antibody was raised in rabbit using the middle region of SIN3B as the immunogen</p>

<p>Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM</p>

<p>TRAFD1 antibody was raised in rabbit using the C terminal of TRAFD1 as the immunogen</p>

<p>ZHX3 antibody was raised in rabbit using the middle region of ZHX3 as the immunogen</p>

<p>CTGFL antibody was raised in rabbit using highly pure recombinant human CTGFL/WISP-2 as the immunogen.</p>

<p>OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA</p>

<p>Purified Polyclonal NKX2.6 antibody</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>LCOR antibody was raised in rabbit using the C terminal of LCOR as the immunogen</p>

<p>Purified Polyclonal BTF3L4 antibody</p>

<p>RASSF1 antibody was raised in rabbit using the C terminal of RASSF1 as the immunogen</p>

<p>KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG</p>

<p>KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids YRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFL</p>

<p>MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogen</p>

<p>The AQP3 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets nucleotide molecules and has shown high affinity for the anti-HER2 antibody trastuzumab. This antibody plays a crucial role in research and diagnostics by detecting and quantifying the presence of specific proteins or antigens.</p>

<p>FAM14A antibody was raised using the middle region of FAM14A corresponding to a region with amino acids LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPK</p>

<p>Ppp2r2c antibody was raised in rabbit using the N terminal of Ppp2r2c as the immunogen</p>

<p>Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA</p>