Primary Antibodies

ATG3 antibody was raised in rabbit using the middle region of ATG3 as the immunogen

MSH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR

GFP antibody was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

<p>MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids  TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE</p>

DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC

<p>RAD17 antibody was raised in rabbit using residues 2-15 [NQVTDWVDPSFDDF] of the human RAD17 protein as the immunogen.</p>

<p>The MMP10 antibody is a highly effective and versatile monoclonal antibody that has a wide range of applications in the field of life sciences. This high-flux cation antibody specifically targets matrix metalloproteinase 10 (MMP10), an enzyme involved in tissue remodeling and inflammation processes.</p>

SI antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK

KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF

Notch 3 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 3 (NOTCH3) protein as the immunogen.

GLT8D1 antibody was raised using the middle region of GLT8D1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG

<p>HERC4 antibody was raised in rabbit using the middle region of HERC4 as the immunogen</p>

OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

PTTG2 antibody was raised in rabbit using the middle region of PTTG2 as the immunogen

<p>HLF antibody was raised in rabbit using the C terminal of HLF as the immunogen</p>

<p>SLC6A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF</p>

Goat anti-rabbit IgG Fc was raised in goat using rabbit igG, Fc fragment as the immunogen.

Mrpl21 antibody was raised in rabbit using the middle region of Mrpl21 as the immunogen

<p>ALS2CR12 antibody was raised in rabbit using the N terminal of ALS2CR12 as the immunogen</p>

<p>Bnc2 antibody was raised in rabbit using the C terminal of Bnc2 as the immunogen</p>

<p>TRIM5 antibody was raised in rabbit using the N terminal of TRIM5 as the immunogen</p>

<p>ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA</p>

<p>The Osteoprotegerin antibody is a polyclonal antibody that targets the glycoprotein Osteoprotegerin. This antibody is widely used in Life Sciences research to study various biological processes, including bone metabolism, cell proliferation, and apoptosis. Osteoprotegerin acts as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand), preventing its binding to RANK (Receptor Activator of Nuclear Factor Kappa-B) and thus inhibiting osteoclastogenesis and bone resorption.</p>

<p>OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogen</p>

C12ORF49 antibody was raised using the C terminal Of C12Orf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY

<p>B3GALT6 antibody was raised using the N terminal of B3GALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS</p>

<p>Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)</p>

Wdr45l antibody was raised in rabbit using the N terminal of Wdr45l as the immunogen

<p>WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV</p>

<p>ZNF689 antibody was raised in rabbit using the N terminal of ZNF689 as the immunogen</p>

<p>SMC1A antibody was raised in rabbit using the C terminal of SMC1A as the immunogen</p>

IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT

Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG

<p>SLC22A17 antibody was raised using the middle region of SLC22A17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM</p>

CCNL2 antibody was raised in rabbit using the N terminal of CCNL2 as the immunogen

PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

<p>C1ORF166 antibody was raised using the middle region of C1Orf166 corresponding to a region with amino acids GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ</p>

HEMGN antibody was raised in rabbit using the N terminal of HEMGN as the immunogen

SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

<p>RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA</p>

ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV

SUZ12 antibody was raised in rabbit using the middle region of SUZ12 as the immunogen

<p>Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI</p>

TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN

<p>ZBTB3 antibody was raised in rabbit using the N terminal of ZBTB3 as the immunogen</p>

Purified Polyclonal CDK5RAP3 antibody

KLF12 antibody was raised in rabbit using the N terminal of KLF12 as the immunogen

GFAP antibody was raised in rabbit using the C terminus of the 50 kDa human protein as the immunogen.

ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND

<p>SETD4 antibody was raised in rabbit using the C terminal of SETD4 as the immunogen</p>

HDGFRP3 antibody was raised in rabbit using the middle region of HDGFRP3 as the immunogen

CCL7 antibody was raised in rabbit using the N terminal of CCL7 as the immunogen

Wnt10a antibody was raised in rabbit using the middle region of Wnt10a as the immunogen

<p>C17ORF78 antibody was raised using the middle region of C17Orf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA</p>

<p>LBX2 antibody was raised in rabbit using the middle region of LBX2 as the immunogen</p>

<p>USP2 antibody was raised in rabbit using the N terminal of USP2 as the immunogen</p>

<p>AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY</p>

<p>MFRP antibody was raised using the middle region of MFRP corresponding to a region with amino acids HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS</p>

<p>SPAG6 antibody was raised in rabbit using the middle region of SPAG6 as the immunogen</p>

ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen

<p>Irf2bp1 antibody was raised in rabbit using the N terminal of Irf2bp1 as the immunogen</p>

<p>B4GALNT1 antibody was raised using the middle region of B4GALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA</p>

LOC390338 antibody was raised in rabbit using the middle region of LOC390338 as the immunogen

<p>AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA</p>

<p>Purified Polyclonal CLIC4 antibody</p>

<p>LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP</p>

<p>PWP1 antibody was raised in rabbit using the C terminal of PWP1 as the immunogen</p>

SLC4A5 antibody was raised using the middle region of SLC4A5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL

<p>Prdm12 antibody was raised in rabbit using the middle region of Prdm12 as the immunogen</p>

<p>ZNF585B antibody was raised in rabbit using the N terminal of ZNF585B as the immunogen</p>

Human synthetic cyclin E1 C-terminal KLH-conjugated immunogen; purified polyclonal Cyclin E1 antibody

EIF3H antibody was raised in rabbit using the C terminal of EIF3H as the immunogen

NKX6-3 antibody was raised in rabbit using the middle region of NKX6-3 as the immunogen

<p>DOR1 antibody was raised in rabbit using a synthetic peptide comprising residues 361-372 TPSDGPGGGAAA of the human DOR-1 protein as the immunogen.</p>

<p>ZNF485 antibody was raised in rabbit using the C terminal of ZNF485 as the immunogen</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>SLC6A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL</p>

KCNN3 antibody was raised using the C terminal of KCNN3 corresponding to a region with amino acids ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA

KLK11 antibody was raised in rabbit using residues 68-82 [YIVHLGQHNLQKEEG] of the 35 kDa human hippostasin/KLK11protein as the immunogen.

<p>CD209 antibody was raised in rabbit using the N terminal of CD209 as the immunogen</p>

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

<p>ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA</p>

<p>GMEB1 antibody was raised in rabbit using the N terminal of GMEB1 as the immunogen</p>

<p>PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRD</p>

<p>The Beta catenin antibody is a protein that plays a crucial role in various biological processes, including cell adhesion and signaling. It interacts with other proteins such as fibronectin, alpha-fetoprotein, and interferon to regulate cell growth and development. This antibody is widely used in Life Sciences research to study the function of β-catenin and its involvement in different cellular pathways.</p>

<p>Klf3 antibody was raised in rabbit using the C terminal of Klf3 as the immunogen</p>

SYT1 antibody was raised in rabbit using the middle region of SYT1 as the immunogen

<p>Abca7 antibody was raised in rabbit using the middle region of Abca7 as the immunogen</p>

Purified Polyclonal NSG2 antibody

LOH11CR2A antibody was raised in rabbit using the N terminal of LOH11CR2A as the immunogen

Pxmp3 antibody was raised in rabbit using the N terminal of Pxmp3 as the immunogen

HKR1 antibody was raised in rabbit using the C terminal of HKR1 as the immunogen

<p>HCC1 antibody was raised in rabbit using highly pure recombinant humam HCC-1 as the immunogen.</p>

<p>GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF</p>

Prmt7 antibody was raised in rabbit using the C terminal of Prmt7 as the immunogen

C8orf70 antibody was raised in rabbit using the middle region of C8ORF70 as the immunogen

C22orf31 antibody was raised in rabbit using the middle region of C22ORF31 as the immunogen

Snx10 antibody was raised in rabbit using the middle region of Snx10 as the immunogen

<p>PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE</p>

<p>RANKL antibody was raised in rabbit using with highly pure recombinant human sRANKL as the immunogen.</p>

BACE2 antibody was raised using the middle region of BACE2 corresponding to a region with amino acids SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF

<p>URP1 antibody was raised in rabbit using residues 643-660 (VHEYIGGYIFLSTRSKDQ) of the 77 kDa human URP1 protein as the immunogen.</p>

FER1L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM

BRD7 antibody was raised in rabbit using the C terminal of BRD7 as the immunogen

The STAT6 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the STAT6 protein. This protein plays a crucial role in the regulation of various cellular processes, including immune response and cell growth. By specifically binding to STAT6, this antibody effectively blocks its activity, preventing the downstream signaling pathways from being activated.

Karyopherin Alpha 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ

<p>DNAJB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA</p>

<p>XPO5 antibody was raised in rabbit using the N terminal of XPO5 as the immunogen</p>

<p>Rabbit polyclonal AFP antibody (Prediluted for IHC)</p>

C15ORF24 antibody was raised using the middle region of C15Orf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

<p>CAV2 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) G L E T E K A D V Q L F M A D D A Y(19) C of rat CAV2 as the immunogen.</p>

GPR83 antibody was raised in rabbit using the C terminal of GPR83 as the immunogen

ZNF227 antibody was raised in rabbit using the N terminal of ZNF227 as the immunogen

<p>RNF144B antibody was raised using the middle region of RNF144B corresponding to a region with amino acids KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

VSTM2A antibody was raised using the middle region of VSTM2A corresponding to a region with amino acids DISHKLQISKVRKKDEGLYECRVTDANYGELQEHKAQAYLKVNANSHARR

HBP1 antibody was raised in rabbit using the middle region of HBP1 as the immunogen

<p>ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW</p>

<p>Claudin 1 antibody was raised using the C terminal of CLDN1 corresponding to a region with amino acids GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV</p>

<p>Purified Polyclonal CCDC102B antibody</p>

<p>CSPG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGGVTAEAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTP</p>

<p>USP29 antibody was raised in rabbit using the N terminal of USP29 as the immunogen</p>

<p>RAB8B antibody was raised in rabbit using the C terminal of RAB8B as the immunogen</p>

CASP4 antibody was raised in rabbit using the middle region of CASP4 as the immunogen

MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV

IL1 beta antibody was raised in rabbit using highly pure recombinant rat IL-1-beta as the immunogen.

LCN1 antibody was raised in rabbit using the C terminal of LCN1 as the immunogen

FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

WDHD1 antibody was raised in rabbit using the middle region of WDHD1 as the immunogen

<p>FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG</p>

<p>IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV</p>

TBX15 antibody was raised in rabbit using the C terminal of TBX15 as the immunogen

<p>TYRP1 antibody was raised using the middle region of TYRP1 corresponding to a region with amino acids NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP</p>

Pfkfb2 antibody was raised in rabbit using the C terminal of Pfkfb2 as the immunogen

<p>Nanog antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Nanog protein as the immunogen.</p>

<p>Purified Polyclonal UBTD1 antibody</p>

HS3ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV

<p>Purified Polyclonal ADPGK antibody</p>

<p>UGT1A1 antibody was raised using the N terminal of UGT1A1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR</p>

MMP26 antibody was raised in rabbit using the C terminal of MMP26 as the immunogen

ZNF793 antibody was raised in rabbit using the middle region of ZNF793 as the immunogen

<p>PTX3 antibody was raised using the N terminal of PTX3 corresponding to a region with amino acids RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL</p>

SGK1 antibody was raised using the N terminal of SGK1 corresponding to a region with amino acids ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

<p>TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK</p>

<p>TMEM30B antibody was raised using the middle region of TMEM30B corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL</p>

CYP11B1 antibody was raised in rabbit using the middle region of CYP11B1 as the immunogen

Purified Polyclonal SHPTP2 antibody

ZNF226 antibody was raised in rabbit using the C terminal of ZNF226 as the immunogen

Meis3 antibody was raised in rabbit using the C terminal of Meis3 as the immunogen

<p>ADNP antibody was raised in rabbit using human 114 kDA hADNP protein as the immunogen.</p>

<p>FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK</p>

ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC

SLC6A15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS

PHF11 antibody was raised in rabbit using the middle region of PHF11 as the immunogen

<p>The PKR antibody is a monoclonal antibody that targets the protein kinase R (PKR). PKR is an important player in antiviral defense and regulates various cellular processes. This antibody specifically recognizes the glycoprotein and can be used for applications such as electrophoresis, antigen-antibody reactions, and neutralization assays. It has been widely used in research studies involving mesenchymal stem cells, fatty acid metabolism, chemokine-like molecules, and reactive oxygen species. Additionally, this antibody has shown potential in therapeutic applications for intraocular diseases. With its high specificity and ability to target PKR, this antibody is a valuable tool for researchers studying antiviral mechanisms and exploring new treatment options.</p>

Purified Polyclonal EDG7 antibody

<p>TAL2 antibody was raised in rabbit using the N terminal of TAL2 as the immunogen</p>

<p>SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED</p>

PSMB9 antibody was raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Uap1l1 antibody was raised in rabbit using the middle region of Uap1l1 as the immunogen

<p>Mouse monoclonal CA 19-9 antibody (Prediluted for IHC)</p>

<p>WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN

<p>TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR</p>

MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP

MTVR antibody was raised in rabbit using residues 152-163 [DDEEPPDASLPPC] of the 20 kDa MMTV-R as the immunogen.

KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

IL19 antibody was raised in rabbit using highly pure recombinant human IL-19 as the immunogen.

Perilipin A antibody was raised in rabbit using a synthetic peptide corresponding to the residues C E(502) P I L G R T Q Y S Q L R K K S(517) of rat Perilipin A as the immunogen.

DHRS7B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA

<p>NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF</p>

<p>Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ</p>

MRE11A antibody was raised in rabbit using the N terminal of MRE11A as the immunogen

<p>C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL</p>