Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Mycophenolic Acid antibody
Mycophenolic Acid antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to various proteins, including β-catenin, dopamine, TNF-α, tyrosine kinase receptors, phosphatases, and nuclear factors. This antibody exhibits cytotoxic activity against cells expressing these proteins and has been extensively used in studies involving antigen detection and antibody-drug conjugates. Mycophenolic Acid antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high specificity and affinity make it an essential component in many research applications.Purity:Min. 95%BTNL8 antibody
BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA
Purity:Min. 95%NAGS antibody
NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
Cathepsin D antibody
The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.
MYL3 antibody
MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.
IL2Ra antibody
IL2Ra antibody was raised in mouse using recombinant human soluble IL-2 Receptor alpha as the immunogen.
IL15Ra antibody
The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.
SPTLC1 antibody
The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.
ZNF764 antibody
ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen
Purity:Min. 95%FGF21 antibody
FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT
Purity:Min. 95%PCDGF antibody
The PCDGF antibody is a highly specialized monoclonal antibody that targets the growth factor associated with non-alcoholic steatohepatitis (NASH). This antibody has been extensively tested and proven to effectively neutralize the activity of this growth factor, preventing its detrimental effects on liver health. By binding to the growth factor, the PCDGF antibody inhibits its ability to induce inflammation and fibrosis in the liver.
Caspase 6 antibody
The Caspase 6 antibody is a highly effective monoclonal antibody used in Life Sciences. This glycoprotein antibody specifically targets caspase 6, an enzyme involved in programmed cell death. By binding to caspase 6, this antibody inhibits its activity and prevents the initiation of apoptosis.
GLUD1 antibody
GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
ZNF454 antibody
ZNF454 antibody was raised in rabbit using the N terminal of ZNF454 as the immunogenPurity:Min. 95%B3GALT1 antibody
B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI
Purity:Min. 95%Synaptotagmin 1 antibody
The Synaptotagmin 1 antibody is a high-quality polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize synaptotagmin 1, a protein involved in neurotransmitter release. This antibody has been extensively tested and proven to be highly effective in various applications, including immunohistochemistry, Western blotting, and ELISA.
Angiotensinogen antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it exhibits high efficacy against Mycobacterium tuberculosis strains. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infection.
DUSP5 antibody
DUSP5 antibody was raised in rabbit using the middle region of DUSP5 as the immunogen
Purity:Min. 95%Desmoplakin 1 + 2 antibody
Desmoplakin 1/2 antibody was raised in mouse using bovine desmoplakin 1&2 as the immunogen.
XRCC5 antibody
The XRCC5 antibody is a substance used in the field of Life Sciences and is commonly used as a biomarker for various purposes. It plays a crucial role in the repair of DNA double-strand breaks and is involved in immune complex formation. XRCC5 antibodies are widely utilized in research studies to detect and analyze the presence of XRCC5 protein, making them valuable tools for understanding cellular processes.
Chlamydia trachomatis MOMP antibody
Chlamydia trachomatis MOMP antibody was raised in mouse using Chlamydia trachomatis elementary bodies as the immunogen.P38 MAPK antibody
The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.
Purity:Min. 95%KLK2 antibody
The KLK2 antibody is a monoclonal antibody that specifically targets the KLK2 protein in human serum. This antibody has been extensively studied and characterized using various techniques, such as molecular docking and polymerase chain reaction (PCR). It has shown high specificity and affinity for the KLK2 protein, making it an ideal tool for research in the field of Life Sciences.
Histamine H3 Receptor antibody
The Histamine H3 Receptor antibody is a high-quality monoclonal antibody that specifically targets the histamine H3 receptor. This antibody is widely used in life sciences research, including studies on human histamine receptors, egf-like growth factors, and cytotoxic assays. It has been proven to be highly effective in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.
CD16 antibody (Allophycocyanin)
CD16 antibody (Allophycocyanin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)
Purity:Min. 95%EEF2 antibody
The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.
FAM98A antibody
FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG
MPT64 antibody
The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.
Calcitonin antibody
The Calcitonin antibody is an anti-connexin agent that specifically targets transthyretin. It is used for immobilization on electrodes and in interferon assays. This monoclonal antibody has been shown to be highly effective in detecting and quantifying activated tyrosine in human serum, making it a valuable tool in Life Sciences research. With its high specificity and sensitivity, this antibody is widely used in various applications, including antigen detection and characterization. Trust the Calcitonin antibody to deliver accurate and reliable results in your research endeavors.LOC642097 antibody
LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL
SLC22A1 antibody
SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
INSR antibody
The INSR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the insulin receptor (INSR) protein, which plays a crucial role in cellular signaling and glucose metabolism. This antibody can be used to study various aspects of INSR function, including its interaction with other proteins such as telomerase, glucagon, β-catenin, and collagen.
Rabbit anti Bovine IgG (biotin)
Rabbit anti-bovine IgG (biotin) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.Purity:Min. 95%MTAP antibody
The MTAP antibody is a highly specialized product in the field of Life Sciences. It is a nuclear monoclonal antibody that has been developed for various applications, including antinociceptive research. This antibody specifically targets the retinoid-binding protein MTAP, which is found in high levels in certain tissues and cells.
CCL5 antibody
The CCL5 antibody is a highly specialized polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the CCL5 protein, a growth factor involved in angiogenesis and inflammation. This antibody can be used in various experimental techniques, such as immunohistochemistry or Western blotting, to study the role of CCL5 in different biological processes. It has been extensively tested and validated for its specificity and effectiveness in binding to the target molecule. Researchers can rely on this high-quality antibody to accurately detect and quantify CCL5 levels in samples, providing valuable insights into its function and potential therapeutic applications.
GPR1 antibody
The GPR1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It belongs to the family of EGFR-like antibodies and has been shown to have neutralizing effects on the activity of EGFR. This antibody can be used in various research applications, including immunohistochemistry and Western blotting, to study the role of EGFR in cell signaling pathways. Additionally, the GPR1 antibody has been used to investigate the interactions between EGFR and other molecules, such as fibronectin and chemokines. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences studying growth factors and their associated signaling pathways.
Human Growth Hormone antibody (HRP)
Human growth hormone antibody (HRP) was raised in mouse using human growth hormone as the immunogen.
ATF4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and contains active compounds that effectively inhibit bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
Donkey anti Goat IgG (H + L)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%GLUR1 antibody
The GLUR1 antibody is a reactive antibody that specifically targets the IL-1 receptor, an important component of the interleukin signaling pathway. This antibody is widely used in Life Sciences research to study the role of IL-1 in various biological processes. Additionally, it has been shown to inhibit the production of pancreatic glucagon, a hormone involved in regulating blood sugar levels.
LCN2 antibody
The LCN2 antibody is a highly specialized antibody that targets sclerostin. It is available in both polyclonal and monoclonal forms, offering a wide range of options for researchers. The antibody has been shown to neutralize prorenin and inhibit glucose-6-phosphate activation, making it a valuable tool for studying these processes. Additionally, the LCN2 antibody can be used in various assays and experiments, thanks to its high specificity and affinity for the target antigen. Its activated colloidal gold conjugate allows for easy visualization and detection using techniques such as immunohistochemistry or Western blotting. Researchers can rely on the LCN2 antibody to provide accurate and reliable results in their studies.
SIGLEC7 antibody
The SIGLEC7 antibody is an inhibitory antibody that targets adeno-associated viruses. It is a polyclonal antibody that specifically binds to the SIGLEC7 receptor, which is expressed on various immune cells. This antibody has been shown to inhibit the activity of serotonin, a neurotransmitter involved in regulating mood and behavior. In addition, it can also bind to antigenic proteins and block their interaction with other molecules. The SIGLEC7 antibody has potential applications in life sciences research and the development of therapeutic antibodies for various diseases. It can be used as a tool to study the function of SIGLEC7 and its role in immune responses. Furthermore, this antibody may have clinical implications as a potential treatment for autoimmune disorders or as a targeted therapy for certain types of cancer.
Goat anti Rat IgM (HRP)
Goat anti-rat IgM (HRP) was raised in goat using rat IgM mu chain as the immunogen.Purity:Min. 95%MDM1 antibody
MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE
Purity:Min. 95%DNM1 antibody
The DNM1 antibody is a highly effective medicament that has shown promising results in inhibiting the growth of carcinoma cell lines. This monoclonal antibody specifically targets a growth factor that is essential for the proliferation of cancer cells, making it a potential breakthrough in cancer treatment. The DNM1 antibody has been extensively studied in Life Sciences and has been proven to be a potent inhibitor of tumor growth. Additionally, this antibody can be used as a selectable marker in research experiments due to its high specificity and sensitivity. With its ability to target specific markers expressed by cancer cells, the DNM1 antibody holds great potential for personalized medicine and targeted therapy approaches.
JNK1 antibody
The JNK1 antibody is a highly specialized product used in Life Sciences research. It is designed to neutralize the activity of the growth factor, interleukin-6, in human serum. This antibody specifically targets and binds to the dimers of interleukin-6, preventing their interaction with cell receptors and inhibiting downstream signaling pathways.
Myc Tag antibody
The Myc Tag antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It is designed to specifically recognize and bind to the Myc epitope tag, a small peptide sequence derived from the c-myc gene. This antibody has been extensively validated for its high affinity and specificity in detecting proteins tagged with the Myc epitope.ZNF548 antibody
ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen
Purity:Min. 95%Epsin 2 antibody
Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM
CD62P antibody
The CD62P antibody is a monoclonal antibody that acts as an inhibitor. It has been shown to prevent hemolysis and inhibit the growth factor in adipose tissue. Additionally, this antibody has demonstrated potential in reducing amyloid plaque formation and targeting activated proteins. It also exhibits cytotoxic effects on Mycoplasma genitalium. The CD62P antibody belongs to the group of Monoclonal Antibodies and is effective against autoantibodies, particularly those targeting annexin.
IL11 antibody (HRP)
IL11 antibody was raised in Mouse using recombinant human IL-11 as the immunogen.DUSP5 antibody
DUSP5 antibody was raised in rabbit using the middle region of DUSP5 as the immunogen
Purity:Min. 95%CD102 antibody (PE)
CD102 antibody (PE) was raised in rat using COS cells transfected with mouse ICAM-2 cDNA as the immunogen.
Purity:Min. 95%PPEF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
DSG3 antibody
DSG3 antibody is a monoclonal antibody used in the field of Life Sciences as an important tool for research and development. It specifically targets the desmoglein 3 protein, which is involved in cell adhesion and plays a crucial role in various physiological processes. The DSG3 antibody can be used to study the function of this protein, investigate its interactions with other molecules such as growth factors or oncolytic adenoviruses, and explore its potential as a therapeutic target.
CD69 antibody (biotin)
CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.
Purity:Min. 95%AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
Triiodothyronine antibody
Triiodothyronine antibody was raised in mouse using triiodothyronine-BSA as the immunogen.Purity:Min. 95%NR2F6 antibody
NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
Archain 1 antibody
Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT
KLK7 antibody
The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.
CIITA antibody
The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.
ApoJ antibody
ApoJ antibody was raised in goat using human apolipoprotein type J as the immunogen.Purity:Min. 95%Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.
Purity:Min. 95%SGK3 antibody
SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%RPL9 antibody
RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
TMEM195 antibody
TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
Purity:Min. 95%ATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Goat anti Human IgG (H + L) (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%IL17F antibody
IL17F antibody was raised in rabbit using highly pure recombinant human IL-17F as the immunogen.Purity:Min. 95%CDC42 antibody
The CDC42 antibody is a highly specific and potent polyclonal antibody that targets the protein CDC42. It can also be used as a monoclonal antibody. CDC42 is a small GTPase protein that plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. This antibody has been extensively tested and validated for its ability to neutralize the activity of CDC42, making it an invaluable tool for researchers in the field of life sciences.
MC5R antibody
The MC5R antibody is a highly specialized monoclonal antibody that binds to the MC5 receptor, a specific type of receptor found in various cells throughout the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
FASL antibody
The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.
CD11b antibody (Spectral Red)
CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%Myoglobin antibody
Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.CD3e antibody (FITC)
CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.
Purity:Min. 95%TRPM4 antibody
The TRPM4 antibody is a highly specialized antibody used in the field of life sciences. It is specifically designed to target and neutralize the TRPM4 protein, which plays a crucial role in cellular processes such as calcium signaling and ion transport. This monoclonal antibody has been extensively tested and proven to be highly reactive and effective in inhibiting the activity of TRPM4.
STEAP3 antibody
STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Purity:Min. 95%Akt antibody
Akt, also known as Protein Kinase B (PKB), is a critical signaling protein in cells that regulates essential processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth, which is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. This allows Akt to influence downstream processes, promoting cell survival by inhibiting apoptosis, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism—especially important for insulin response.Akt plays a significant role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.
PDPN antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes.
PMVK antibody
The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.
Donkey anti Rabbit IgG (H + L) (biotin)
Donkey anti-Rabbit IgG (H + L) (biotin) was raised in donkey using purified Rabbit IgG (H&L) as the immunogen.Purity:Min. 95%MEK5 antibody
The MEK5 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to the MEK5 protein, which plays a crucial role in granulosa cell growth and development. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA.
Purity:Min. 95%CD24 antibody (Spectral Red)
CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%Tau antibody
The Tau antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets and binds to the protein Tau, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. The antibody has been extensively studied and validated for its specificity and sensitivity.Purity:Min. 95%CDC45L antibody
The CDC45L antibody is a highly specialized monoclonal antibody that targets the CDC45L protein. This protein plays an important role in various biological processes, including DNA replication and cell cycle regulation. By specifically binding to CDC45L, this antibody can effectively inhibit its function and disrupt these processes.
SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Purity:Min. 95%TRPC6 antibody
The TRPC6 antibody is a growth factor-neutralizing monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) protein complex. This antibody is designed to bind to and neutralize the activity of AFP, which plays a crucial role in promoting cell growth and proliferation. By blocking AFP, the TRPC6 antibody inhibits the signaling pathways that contribute to tumor development and progression.
TAFI antibody (HRP)
TAFI antibody (HRP) was raised in sheep using human TAFI purified from plasma as the immunogen.EED antibody
The EED antibody is a highly specialized and potent anti-mesothelin antibody that is widely used in Life Sciences research. It has the ability to bind specifically to mesothelin, a protein that is involved in cell growth and signaling pathways. This antibody is commonly used in studies related to growth factors, chemokines, and other important biological processes. Additionally, the EED antibody has been shown to have neutralizing properties against mesothelin, making it an ideal tool for studying the effects of this protein in various experimental settings. It can be used in a variety of applications including immunohistochemistry, Western blotting, ELISA, and more. With its high specificity and affinity for mesothelin, the EED antibody provides researchers with a valuable tool for understanding the role of this protein in disease development and progression.
Caspase 1 antibody
The Caspase 1 antibody is a highly effective tool for immunoassays and research purposes. This antibody specifically targets caspase 1, a key enzyme involved in inflammatory responses and cell death. It has been shown to neutralize the activity of caspase 1, making it an essential component for studies related to fibronectin, insulin, collagen, β-catenin, and other growth factors.
Testosterone 19 antibody
Testosterone 19 antibody was raised in rabbit using testosterone-19-HSA as the immunogen.
Purity:Min. 95%YTHDF1 antibody
The YTHDF1 antibody is a highly specialized monoclonal antibody that targets the YTH domain family protein 1 (YTHDF1). This peptide system plays a crucial role in various biological processes, including RNA metabolism and translation regulation. The YTHDF1 antibody is designed to specifically bind to YTHDF1 and neutralize its activity.
Goat anti Human IgM (mu chain) (HRP)
This antibody reacts with heavy chains on human IgM (mu chain).Purity:Min. 95%DKK1 antibody
DKK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%SMAD4 antibody
The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.
P-Selectin antibody
The P-Selectin antibody is an amide-based monoclonal antibody that specifically targets the glycoprotein P-Selectin. This medicament is widely used in the field of Life Sciences for various biochemical studies and research purposes. The P-Selectin antibody can be utilized in experiments involving microspheres, as well as for the detection and analysis of activated cells expressing P-Selectin. Additionally, this antibody has shown affinity towards other proteins such as E-Cadherin, making it a versatile tool for studying cell adhesion and signaling pathways. With its high specificity and sensitivity, the P-Selectin antibody is a valuable asset in the field of immunology and molecular biology research.
GTPBP2 antibody
GTPBP2 antibody was raised using the C terminal of GTPBP2 corresponding to a region with amino acids VLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL
p73 antibody
The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.
Purity:Min. 95%CD90 antibody
The CD90 antibody is a highly specific polyclonal antibody that targets the CD90 antigen, also known as Thy-1. It is commonly used in research and diagnostic applications to detect and analyze human proteins. This antibody has been extensively validated for its high affinity and specificity in various assays, including immunohistochemistry, flow cytometry, and western blotting.
NEDD1 antibody
NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV
