Primary Antibodies

<p>Purified Polyclonal MKK1/2 antibody</p>

SERPINB13 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

<p>IGSF8 antibody was raised in rabbit using the middle region of IGSF8 as the immunogen</p>

<p>PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA</p>

Albumin antibody was raised using the N terminal of ALB corresponding to a region with amino acids YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET

<p>GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen</p>

<p>GLOD4 antibody was raised in rabbit using the N terminal of GLOD4 as the immunogen</p>

<p>Mouse monoclonal EpCAM antibody (Prediluted for IHC)</p>

<p>CYP2A7 antibody was raised using the N terminal of CYP2A7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN</p>

<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR</p>

<p>APOL5 antibody was raised in rabbit using the C terminal of APOL5 as the immunogen</p>

<p>CSNK1A1L antibody was raised in rabbit using the middle region of CSNK1A1L as the immunogen</p>

Cish antibody was raised in rabbit using the N terminal of Cish as the immunogen

DPPA5 antibody was raised in rabbit using residues 43-60 [RIPYIEQVSKAMLELKAL] of the ~14 kDa human DPPA5 protein as the immunogen.

KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV

<p>The STAT5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes tyrosinase, an enzyme involved in melanin production. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The STAT5 antibody has been extensively validated and has shown excellent specificity and sensitivity in detecting tyrosinase expression. It can be used to study melanoma progression, evaluate the efficacy of anti-tyrosinase therapies, and explore the role of tyrosinase in other biological processes. Whether you are a researcher or a pharmaceutical company working on developing new treatments for skin disorders, the STAT5 antibody is an essential tool for your studies.</p>

<p>FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE</p>

<p>SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR</p>

Loxl2 antibody was raised in rabbit using the C terminal of Loxl2 as the immunogen

Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT

<p>B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI</p>

<p>GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF</p>

<p>hCG_1646157 antibody was raised in rabbit using the N terminal of HCG_1646157 as the immunogen</p>

<p>ACVR2B antibody was raised in rabbit using the middle region of ACVR2B as the immunogen</p>

<p>KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ</p>

IL1F5 antibody was raised in rabbit using the C terminal of IL1F5 as the immunogen

<p>ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY</p>

<p>PRKCG antibody was raised using the N terminal of PRKCG corresponding to a region with amino acids FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL</p>

<p>AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI</p>

<p>IFT88 antibody was raised in rabbit using the middle region of IFT88 as the immunogen</p>

<p>CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA</p>

<p>The TAU antibody is a diagnostic agent used in immunochemical studies to detect the presence of TAU protein. It is particularly useful in detecting abnormal levels of TAU protein in human serum, cerebrospinal fluid, and primary neuron cultures. The TAU antibody specifically binds to TAU protein and can be used for the identification and quantification of TAU protein in various biological samples. This monoclonal antibody has high affinity and specificity for TAU protein, making it an excellent tool for research purposes. Whether you're studying synaptic proteins or investigating neurodegenerative diseases characterized by the accumulation of amyloid plaques, the TAU antibody is a valuable asset in your scientific arsenal.</p>

<p>SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT</p>

PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

<p>MCT1 antibody was raised in rabbit using residues 3-14[KKFDEKENVSNC] of the 20 kDa MCT-1 protein as the immunogen.</p>

<p>Mouse monoclonal Sialosyl-Tn antigen antibody</p>

Carboxylesterase 7 antibody was raised using the middle region of CES7 corresponding to a region with amino acids LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF

<p>SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT</p>

<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH</p>

<p>Plasminogen antibody was raised against Human Plasminogen.</p>

REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

<p>KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL</p>

<p>DCX antibody was raised using a synthetic peptide corresponding to a region with amino acids TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPIS</p>

<p>KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL</p>

<p>ZNF468 antibody was raised in rabbit using the middle region of ZNF468 as the immunogen</p>

<p>ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen</p>

<p>hCG_2042202 antibody was raised in rabbit using the C terminal of HCG_2042202 as the immunogen</p>

PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL

<p>AP1B1 antibody was raised in rabbit using the C terminal of AP1B1 as the immunogen</p>

EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids  KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

<p>MAML3 antibody was raised in rabbit using the middle region of MAML3 as the immunogen</p>

<p>Exodus 2 antibody was raised in rabbit using highly pure recombinant murine exodus-2 as the immunogen.</p>

<p>Sohlh1 antibody was raised in rabbit using the middle region of Sohlh1 as the immunogen</p>

<p>SIN3B antibody was raised in rabbit using the middle region of SIN3B as the immunogen</p>

The HIF1 alpha antibody is a highly specialized biomolecule used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and Monoclonal Antibodies, which are widely recognized for their antigen-binding capabilities. This antibody specifically targets the growth factor known as interleukin-6 (IL-6), an important molecule involved in various biological processes.

<p>ZC3H15 antibody was raised in rabbit using the middle region of ZC3H15 as the immunogen</p>

<p>Calmin antibody was raised using a synthetic peptide corresponding to a region with amino acids SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK</p>

VCP antibody was raised in rabbit using the C terminal of VCP as the immunogen

<p>OR2A5 antibody was raised in rabbit using the C terminal of OR2A5 as the immunogen</p>

TUT1 antibody was raised in rabbit using the middle region of TUT1 as the immunogen

<p>SLC13A3 antibody was raised in rabbit using the C terminal of SLC13A3 as the immunogen</p>

COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

<p>Myocd antibody was raised in rabbit using the N terminal of Myocd as the immunogen</p>

ZZZ3 antibody was raised in rabbit using the middle region of ZZZ3 as the immunogen

TRIM56 antibody was raised in rabbit using the middle region of TRIM56 as the immunogen

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has shown its high efficacy through the use of advanced techniques such as transcription-quantitative polymerase chain reaction and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its specific binding to markers expressed in Mycobacterium tuberculosis strains further contributes to its effectiveness in inhibiting cell growth. Experience the power of 6-Fluoro-3-indoxyl-beta-D-gal</p>

<p>EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP</p>

<p>SLC24A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS</p>

<p>NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS</p>

<p>SERPINA10 antibody was raised in rabbit using the middle region of SERPINA10 as the immunogen</p>

<p>ANGPTL2 antibody was raised using the N terminal of ANGPTL2 corresponding to a region with amino acids NSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVK</p>

<p>DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK</p>

<p>Zdhhc11 antibody was raised in rabbit using the middle region of Zdhhc11 as the immunogen</p>

<p>Purified Polyclonal AF4 antibody</p>

<p>GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE</p>

<p>NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK</p>

<p>Tcea3 antibody was raised in rabbit using the C terminal of Tcea3 as the immunogen</p>

<p>KCNJ16 antibody was raised using the middle region of KCNJ16 corresponding to a region with amino acids RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL</p>

<p>SETBP1 antibody was raised in rabbit using the middle region of SETBP1 as the immunogen</p>

<p>FSCN2 antibody was raised in rabbit using the middle region of FSCN2 as the immunogen</p>

<p>RPS27A antibody was raised in rabbit using the middle region of RPS27A as the immunogen</p>

<p>PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA</p>

<p>Purified Polyclonal HECW2 antibody</p>

<p>KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK</p>

The ADRA2C antibody is a polyclonal antibody that specifically targets the ADRA2C receptor. This receptor is involved in various physiological processes, including the regulation of blood pressure, neurotransmitter release, and vasoconstriction. The ADRA2C antibody can be used in life sciences research to study the role of this receptor in different cellular pathways.

C-myc antibody was raised in goat using a synthetic peptide representing amino acid residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.

<p>Purified Polyclonal CEACAM21 antibody</p>

<p>C14ORF180 antibody was raised using the middle region of C14Orf180 corresponding to a region with amino acids PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG</p>

<p>MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGS</p>

<p>Rabbit polyclonal Luteinizing Hormone antibody (Prediluted for IHC)</p>

<p>The CRK antibody is a polyclonal antibody that specifically targets helicobacter and is used for various applications in research and diagnostics. This antibody has high colloidal stability, making it ideal for use in immunoassays. It can be used to detect and quantify the presence of multidrug-resistant strains of helicobacter in samples. Additionally, the CRK antibody has been shown to bind to collagen, a key component of the extracellular matrix, suggesting its potential role in studying tissue remodeling processes. This antibody also exhibits binding activity towards growth factors such as interleukin-6 and erythropoietin, indicating its utility in investigating signaling pathways involved in cell proliferation and differentiation. The CRK antibody is available as both polyclonal and monoclonal forms, providing researchers with options depending on their specific experimental needs. Its histidine tag allows for easy purification, ensuring high-quality results. With its versatility and broad application range, the CRK antibody is an essential tool for studying</p>

<p>KIF25 antibody was raised using the N terminal of KIF25 corresponding to a region with amino acids TWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLT</p>

<p>HABP2 antibody was raised using the middle region of HABP2 corresponding to a region with amino acids EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI</p>

<p>CYP2C9 antibody was raised using the C terminal of CYP2C9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV</p>

<p>C3ORF18 antibody was raised using the N terminal Of C3Orf18 corresponding to a region with amino acids NSRTASARGWFSSRPPTSESDLEPATDGPASETTTLSPEATTFNDTRIPD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The active form of this drug has been extensively studied using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

YIPF1 antibody was raised using the middle region of YIPF1 corresponding to a region with amino acids HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS

<p>Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN</p>

ETV3L antibody was raised in rabbit using the middle region of ETV3L as the immunogen

PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL

<p>Tmem110 antibody was raised in rabbit using the C terminal of Tmem110 as the immunogen</p>

<p>DCX antibody was raised using a synthetic peptide corresponding to a region with amino acids PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR</p>

OR10X1 antibody was raised using the middle region of OR10X1 corresponding to a region with amino acids  NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP

<p>CHRFAM7A antibody was raised using the middle region of CHRFAM7A corresponding to a region with amino acids DSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLN</p>

<p>Jph2 antibody was raised in rabbit using the N terminal of Jph2 as the immunogen</p>

<p>KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL</p>

<p>MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM</p>

<p>Sgk3 antibody was raised in rabbit using the C terminal of Sgk3 as the immunogen</p>

<p>GAS2L1 antibody was raised using the middle region of GAS2L1 corresponding to a region with amino acids ARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSPAAP</p>

<p>IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL</p>

<p>CDC25B antibody was raised using a synthetic peptide corresponding to a region with amino acids TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE</p>

<p>Mouse monoclonal Cytokeratin 10+13 antibody (Prediluted for IHC)</p>

Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR

<p>PLCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT</p>

<p>TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD</p>

Nanog antibody was raised in rabbit using highly pure recombinant human nanog as the immunogen.

LASS1 antibody was raised using the middle region of LASS1 corresponding to a region with amino acids LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR

<p>GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLS</p>

<p>C20ORF10 antibody was raised using the middle region of C20Orf10 corresponding to a region with amino acids TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN</p>

<p>KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG</p>

ZIC5 antibody was raised in rabbit using the N terminal of ZIC5 as the immunogen

<p>CYP46A1 antibody was raised using the C terminal of CYP46A1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM</p>

<p>HSFY1 antibody was raised in rabbit using the N terminal of HSFY1 as the immunogen</p>

<p>CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRM</p>

B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY

<p>CD8B antibody was raised using the middle region of CD8B corresponding to a region with amino acids KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR</p>

<p>TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC</p>

<p>HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG</p>

<p>Ebf3 antibody was raised in rabbit using the N terminal of Ebf3 as the immunogen</p>

<p>FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE</p>

<p>Affinity purified Goat anti Pig IgM antibody</p>

<p>IFT172 antibody was raised in rabbit using the N terminal of IFT172 as the immunogen</p>

<p>Rabbit polyclonal CRP antibody (Prediluted for IHC)</p>

<p>Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA</p>

<p>Goat anti-monkey IgM was raised in goat using monkey IgM as the immunogen.</p>

<p>TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP</p>

<p>SLC16A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT</p>

<p>SP6 antibody was raised in rabbit using the C terminal of SP6 as the immunogen</p>

<p>LOC641765 antibody was raised in rabbit using the C terminal of LOC641765 as the immunogen</p>

<p>BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV</p>

<p>OR2B2 antibody was raised in rabbit using the C terminal of OR2B2 as the immunogen</p>

<p>LRRC37B antibody was raised using the N terminal of LRRC37B corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS</p>

<p>Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen</p>

<p>Ascc1 antibody was raised in rabbit using the C terminal of Ascc1 as the immunogen</p>

<p>ST3GAL1 antibody was raised using the C terminal of ST3GAL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN</p>

PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY

The Syntaxin 1A antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Syntaxin 1A, a protein involved in vesicle fusion and neurotransmitter release. This antibody is commonly used in various assays to study the activation and localization of Syntaxin 1A in different cellular contexts.

<p>GTF2B antibody was raised in rabbit using the C terminal of GTF2B as the immunogen</p>

Sec31a antibody was raised in rabbit using the N terminal of Sec31a as the immunogen

ARG2 antibody was raised in rabbit using the N terminal of ARG2 as the immunogen

<p>Purified Polyclonal AKAP10 antibody</p>

<p>PAP2D antibody was raised using the N terminal of PAP2D corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET</p>

MICALL1 antibody was raised in rabbit using the N terminal of MICALL1 as the immunogen

<p>GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN</p>

<p>MRPL17 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly used for the detection and analysis of MRPL17 protein expression in various biological samples, including pleural fluid, human serum, and tissue sections. This antibody specifically binds to MRPL17, a key component of the mitochondrial ribosome that plays a crucial role in protein synthesis within the mitochondria.</p>

<p>GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF</p>

<p>SLC25A32 antibody was raised using the N terminal of SLC25A32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT</p>

<p>TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL</p>

The NF kappaB p65 antibody is a polyclonal antibody that specifically targets the protein NF kappaB p65. This antibody is widely used in life sciences research to study the role of NF kappaB p65 in various biological processes. NF kappaB p65 is a transcription factor that plays a crucial role in regulating gene expression. It forms a complex with other proteins and binds to specific DNA sequences, thereby controlling the transcription of target genes involved in immune response, inflammation, cell survival, and development.

Shc3 antibody was raised in rabbit using the N terminal of Shc3 as the immunogen

<p>SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS</p>

<p>GK2 antibody was raised in rabbit using the N terminal of GK2 as the immunogen</p>

<p>PLA2G2E antibody was raised in rabbit using the middle region of PLA2G2E as the immunogen</p>

<p>FBXW7 antibody was raised using the C terminal of FBXW7 corresponding to a region with amino acids  LKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL</p>

MESP1 antibody was raised in rabbit using the N terminal of MESP1 as the immunogen

<p>CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL</p>

<p>PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL</p>

<p>PAR1 antibody is a Polyclonal Antibody used in Life Sciences research. It is designed to target the PAR1 receptor, which plays a crucial role in various physiological processes including coagulation, chemotherapy, and mineralocorticoid signaling. This antibody specifically binds to the extracellular domain of the PAR1 receptor, neutralizing its activity and preventing downstream signaling events. It has been extensively used as a tool in studying the function of PAR1 and its involvement in disease processes. The high specificity and affinity of this antibody make it an ideal choice for researchers looking to investigate the role of PAR1 in different biological systems.</p>

<p>Galectin 8 antibody is a monoclonal antibody used in Life Sciences research. It plays a crucial role in various biological processes such as electrode signaling and fas-mediated apoptosis. This antibody specifically targets galectin 8, a protein involved in lipoprotein lipase activity and glycation processes. Galectin 8 antibody can be used for various applications, including antiviral studies, detection of glycosylation patterns, and analysis of interferon signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with versatile options for their experiments. With its high specificity and sensitivity, Galectin 8 antibody is an essential tool for studying the functions and interactions of this important protein in different cellular processes.</p>

<p>EXOC1 antibody was raised in rabbit using the N terminal of EXOC1 as the immunogen</p>

AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA

<p>ALOX15B antibody was raised using the middle region of ALOX15B corresponding to a region with amino acids CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI</p>

<p>ZNF451 antibody was raised in rabbit using the C terminal of ZNF451 as the immunogen</p>