Primary Antibodies

<p>PHF11 antibody was raised in rabbit using the n terminal of PHF11 as the immunogen</p>

<p>CCPG1 antibody was raised using the middle region of CCPG1 corresponding to a region with amino acids TNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKE</p>

<p>UGCGL2 antibody was raised using the N terminal of UGCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR</p>

<p>RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ</p>

<p>RNF5 antibody was raised in rabbit using the N terminal of RNF5 as the immunogen</p>

<p>The CYR61 antibody is a highly specific and potent antibody that targets various antigens in the body. It has been extensively studied for its ability to bind to glp-1, myostatin, α-syn, hemoglobin, circumsporozoite protein, and other important molecules. This antibody can be used in a wide range of applications, including immunoassays and research experiments.</p>

<p>FKLF antibody was raised in rabbit using residues 26-36 [ERKRHDSERST] of the FKLF protein as the immunogen.</p>

<p>MSL3L2 antibody was raised in rabbit using the middle region of MSL3L2 as the immunogen</p>

<p>C20ORF10 antibody was raised using the N terminal Of C20Orf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN</p>

<p>MAP3K11 antibody was raised using the middle region of MAP3K11 corresponding to a region with amino acids PVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPR</p>

<p>BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL</p>

The TDG antibody is a polyclonal antibody that is widely used in the field of life sciences. It is a biomaterial that specifically targets and binds to TDG (thymine-DNA glycosylase), an enzyme involved in DNA repair and epigenetic regulation. This antibody has been shown to be highly effective in neutralizing the activity of TDG, making it an essential tool for studying its function and role in various biological processes.

<p>Tfdp1 antibody was raised in rabbit using the N terminal of Tfdp1 as the immunogen</p>

<p>Alien antibody was raised in rabbit using Residues 239-250 [ECGGKMHLREGE] of Alien as the immunogen.</p>

<p>EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA</p>

<p>TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK</p>

TIMP1 antibody was raised in rabbit using highly pure recombinant human TIMP-1 as the immunogen.

<p>Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA</p>

<p>OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN</p>

<p>hCG_2007354 antibody was raised in rabbit using the n terminal of hCG_2007354 as the immunogen</p>

<p>Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG</p>

<p>C10ORF57 antibody was raised using the middle region of C10Orf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH</p>

STIM1 antibody was raised using the middle region of STIM1 corresponding to a region with amino acids LDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS

<p>TRIT1 antibody was raised in rabbit using the middle region of TRIT1 as the immunogen</p>

USP35 antibody was raised in rabbit using the C terminal of USP35 as the immunogen

MAGEA2 antibody was raised in rabbit using the N terminal of MAGEA2 as the immunogen

Wnt1 antibody was raised in rabbit using highly pure recombinant human WNT-1 as the immunogen.

<p>RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV</p>

<p>FBG3 antibody was raised in rabbit using residues 103-119 (EWKVEDLSRDQRKEFPN) of the human FBG3 protein as the immunogen.</p>

<p>Commd2 antibody was raised in rabbit using the middle region of Commd2 as the immunogen</p>

<p>CNTN1 antibody was raised in rabbit using the N terminal of CNTN1 as the immunogen</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR</p>

<p>SLC15A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV</p>

<p>LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL</p>

<p>GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen</p>

<p>AKAP8 antibody was raised in rabbit using the middle region of AKAP8 as the immunogen</p>

<p>IL21 antibody was raised in rabbit using highly pure recombinant murine IL-21 as the immunogen.</p>

<p>HSF5 antibody was raised in rabbit using the middle region of HSF5 as the immunogen</p>

ISG15 antibody was raised in rabbit using the middle region of ISG15 as the immunogen

<p>WDFY3 antibody was raised in rabbit using the C terminal of WDFY3 as the immunogen</p>

<p>PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM</p>

SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

<p>ZNF780B antibody was raised in rabbit using the N terminal of ZNF780B as the immunogen</p>

<p>ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG</p>

<p>RAB15 antibody was raised in rabbit using the middle region of RAB15 as the immunogen</p>

<p>Notch 1 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 1 (NOTCH1) protein as the immunogen.</p>

Sepn1 antibody was raised in rabbit using the C terminal of Sepn1 as the immunogen

<p>ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE</p>

<p>ATXN2 antibody was raised in rabbit using the middle region of ATXN2 as the immunogen</p>

<p>Purified Polyclonal ATRIP antibody</p>

ESSPL antibody was raised using the N terminal of ESSPL corresponding to a region with amino acids MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGS

<p>IL18R1 antibody was raised using the N terminal of IL18R1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE</p>

<p>RFP2 antibody was raised in rabbit using the middle region of RFP2 as the immunogen</p>

Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW

<p>ZNF687 antibody was raised in rabbit using the C terminal of ZNF687 as the immunogen</p>

BRAF35 antibody was raised in rabbit using residues 31-50 [KQERGEGPRA GEKGSHEEEP] of the human structural DNA-binding protein BRAF35 as the immunogen.

<p>MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>RBBP5 antibody was raised in rabbit using the middle region of RBBP5 as the immunogen</p>

<p>JAZF1 antibody was raised in rabbit using the C terminal of JAZF1 as the immunogen</p>

<p>TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK</p>

Purified Rabbit polyclonal TIFIA antibody

PPP5C antibody was raised in rabbit using the middle region of PPP5C as the immunogen

<p>SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL</p>

<p>LUC7L antibody was raised in rabbit using the N terminal of LUC7L as the immunogen</p>

<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>

<p>USP47 antibody was raised in rabbit using the middle region of USP47 as the immunogen</p>

<p>Vgll2 antibody was raised in rabbit using the N terminal of Vgll2 as the immunogen</p>

<p>Eras antibody was raised in rabbit using the N terminal of Eras as the immunogen</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

Purified Polyclonal LATH antibody

<p>XYLT1 antibody was raised in rabbit using the middle region of XYLT1 as the immunogen</p>

<p>HOMEZ antibody was raised in rabbit using the middle region of HOMEZ as the immunogen</p>

<p>PKD2 antibody was raised in rabbit using human PKD2 protein as the immunogen.</p>

<p>DRAM antibody was raised in rabbit using the N terminal of DRAM as the immunogen</p>

<p>C9ORF127 antibody was raised using the N terminal Of C9Orf127 corresponding to a region with amino acids MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS</p>

<p>FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV</p>

SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF

<p>TRAIL receptor 4 antibody was raised in rabbit using N terminus of the mature human TRAIL-R4 protein as the immunogen.</p>

ZNF550 antibody was raised in rabbit using the N terminal of ZNF550 as the immunogen

<p>DNM1L antibody was raised in rabbit using the N terminal of DNM1L as the immunogen</p>

<p>Rod1 antibody was raised in rabbit using the N terminal of Rod1 as the immunogen</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant rat TNF-alpha as the immunogen.</p>

<p>IL1 alpha antibody was raised in rabbit using highly pure recombinant human IL-1a as the immunogen.</p>

Hoxb9 antibody was raised in rabbit using the middle region of Hoxb9 as the immunogen

Pleiotrophin antibody was raised using a synthetic peptide corresponding to a region with amino acids LNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEG

<p>IL6 antibody was raised in rabbit using highly pure recombinant rat IL-6 as the immunogen.</p>

<p>BRF2 antibody was raised in rabbit using the middle region of BRF2 as the immunogen</p>

<p>Purified Polyclonal CD2BP2 antibody</p>

<p>RPS6KA2 antibody was raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR</p>

The LKB1 antibody is a monoclonal antibody that specifically targets the growth hormone receptor. It is commonly used in Life Sciences research to study the role of this receptor in various cellular processes. The LKB1 antibody binds to the antigen on the growth hormone receptor, blocking its activity and preventing downstream signaling events. This antibody can be used in experiments to investigate the effects of inhibiting the growth hormone receptor, such as studying cell proliferation, differentiation, and survival. Additionally, the LKB1 antibody can be used in combination with other antibodies or inhibitors to explore potential therapeutic applications. With its high specificity and affinity for the target protein, the LKB1 antibody is a valuable tool for researchers in the field of molecular biology and drug discovery.

<p>C3ORF64 antibody was raised using the C terminal Of C3Orf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL</p>

PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQD

<p>SLC45A3 antibody was raised using the middle region of SLC45A3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS</p>

CAND2 antibody was raised in rabbit using the N terminal of CAND2 as the immunogen

<p>GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW</p>

<p>SLC39A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS</p>

<p>ZNF707 antibody was raised in rabbit using the N terminal of ZNF707 as the immunogen</p>

<p>BTNL8 antibody was raised in rabbit using the middle region of BTNL8 as the immunogen</p>

SIGLEC6 antibody was raised using the middle region of SIGLEC6 corresponding to a region with amino acids FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT

<p>F7 antibody was raised in rabbit using the C terminal of F7 as the immunogen</p>

<p>IQCB1 antibody was raised in rabbit using the C terminal of IQCB1 as the immunogen</p>

<p>ZBTB9 antibody was raised in rabbit using the N terminal of ZBTB9 as the immunogen</p>

<p>ZNF785 antibody was raised in rabbit using the N terminal of ZNF785 as the immunogen</p>

ZNF322A antibody was raised in rabbit using the N terminal of ZNF322A as the immunogen

<p>SMYD3 antibody was raised in rabbit using the C terminal of SMYD3 as the immunogen</p>

<p>SSX6 antibody was raised in rabbit using the middle region of SSX6 as the immunogen</p>

<p>Purified Rabbit polyclonal MADS4 antibody</p>

<p>Abcc12 antibody was raised in rabbit using the middle region of Abcc12 as the immunogen</p>

<p>The HA tag antibody is a valuable tool in the field of Life Sciences. It is commonly used to detect and study proteins that have been tagged with the HA epitope. The HA tag, derived from the influenza hemagglutinin protein, consists of a short peptide sequence (YPYDVPDYA) that can be easily recognized by specific antibodies.</p>

CBLN1 antibody was raised in rabbit using the C terminal of CBLN1 as the immunogen

<p>ALAD antibody was raised in rabbit using the N terminal of ALAD as the immunogen</p>

Aquaporin 10 antibody was raised using the middle region of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK

<p>OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH</p>

CDC45L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED

<p>C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP</p>

<p>STAT5B antibody was raised in rabbit using the N terminal of STAT5B as the immunogen</p>

<p>NAP2 antibody was raised in rabbit using highly pure recombinant hNAP-2 as the immunogen.</p>

<p>Ccbe1 antibody was raised in rabbit using the C terminal of Ccbe1 as the immunogen</p>

<p>Rabbit polyclonal p57KIP2 antibody</p>

<p>NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP</p>

NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI

<p>Esrra antibody was raised in rabbit using the C terminal of Esrra as the immunogen</p>

<p>PYGO1 antibody was raised in rabbit using the N terminal of PYGO1 as the immunogen</p>

Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL

<p>ZNF550 antibody was raised in rabbit using the N terminal of ZNF550 as the immunogen</p>

LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP

<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>

<p>Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>The MARK antibody is a monoclonal antibody that specifically targets and binds to the activated form of fatty acid. It is designed to recognize and interact with a specific antigen, such as interleukins or IFN-gamma, which are involved in various biological processes including cell growth and immune response. This antibody can be used in life sciences research to study the role of these molecules in different pathways and diseases. Additionally, the MARK antibody can also be utilized as an inhibitor by blocking the interaction between the targeted molecule and its receptors, thus modulating specific cellular functions. With its high specificity and affinity, this antibody is a valuable tool for researchers in their quest to understand complex biological mechanisms.</p>

<p>SCAMP3 antibody was raised in rabbit using the N terminal of SCAMP3 as the immunogen</p>

<p>CANX antibody was raised in rabbit using the middle region of CANX as the immunogen</p>

RGS9 antibody was raised using the middle region of RGS9 corresponding to a region with amino acids LKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWES

<p>TREML2 antibody was raised in rabbit using the N terminal of TREML2 as the immunogen</p>

Mouse monoclonal S100 antibody (Prediluted for IHC)

Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE

<p>MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen</p>

<p>ZNF91 antibody was raised in rabbit using the N terminal of ZNF91 as the immunogen</p>

<p>SERPINE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA</p>

MAGEC2 antibody was raised in rabbit using the N terminal of MAGEC2 as the immunogen

SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV

<p>FLJ10490 antibody was raised in rabbit using the middle region of FLJ10490 as the immunogen</p>

<p>MSI1 antibody was raised in rabbit using residues 5-21 [APQPGLASPDSPHDPCK] of the human mushashi protein as the immunogen.</p>

<p>PHOSPHO2 antibody was raised in rabbit using the N terminal of PHOSPHO2 as the immunogen</p>

SLC6A2 antibody was raised in rabbit using the middle region of SLC6A2 as the immunogen

<p>Affinity purified Goat polyclonal MSR Type 1 antibody</p>

<p>ADORA2B antibody was raised in rabbit using the C terminal of ADORA2B as the immunogen</p>

<p>RANTES antibody was raised in rabbit using highly pure recombinant rat RANTES as the immunogen.</p>

<p>Purified Polyclonal EMP antibody</p>

C1QTNF1 antibody was raised using the N terminal of C1QTNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS

<p>ZXDA antibody was raised in rabbit using the middle region of ZXDA as the immunogen</p>

<p>DAPK1 antibody was raised using the N terminal of DAPK1 corresponding to a region with amino acids MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK</p>

<p>DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE</p>

FOXO3A antibody was raised in rabbit using the C terminal of FOXO3A as the immunogen

CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE

<p>PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE</p>

<p>TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR</p>

<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL</p>

<p>Hmx3 antibody was raised in rabbit using the middle region of Hmx3 as the immunogen</p>

<p>TMEM176A antibody was raised using the middle region of TMEM176A corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ</p>

<p>Fibrinogen Alpha antibody was raised using the middle region of FGA corresponding to a region with amino acids SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK</p>

PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL

<p>ZNF385D antibody was raised in rabbit using the N terminal of ZNF385D as the immunogen</p>

DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS

<p>ZFP28 antibody was raised in rabbit using the middle region of ZFP28 as the immunogen</p>

eIF5A2 antibody was raised in rabbit using residues 108-122 [VREDLKLPEGELGKE] of the 17 kDa human, mouse and rat EIF5A2 protein as the immunogen.

<p>RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY</p>

<p>HS3ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV</p>

<p>Purified Polyclonal ADPGK antibody</p>

<p>UGT1A1 antibody was raised using the N terminal of UGT1A1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR</p>

<p>ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR</p>

<p>MMP26 antibody was raised in rabbit using the C terminal of MMP26 as the immunogen</p>

<p>ZNF793 antibody was raised in rabbit using the middle region of ZNF793 as the immunogen</p>