Primary Antibodies

<p>SLC38A3 antibody was raised using the N terminal of SLC38A3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM</p>

<p>FGF basic antibody was raised in rabbit using highly pure recombinant human FGF-basic as the immunogen.</p>

<p>ATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW</p>

<p>Pcdh11x antibody was raised in rabbit using the middle region of Pcdh11x as the immunogen</p>

<p>Dhrs7 antibody was raised in rabbit using the N terminal of Dhrs7 as the immunogen</p>

<p>Vps72 antibody was raised in rabbit using the N terminal of Vps72 as the immunogen</p>

<p>ZFP90 antibody was raised in rabbit using the middle region of ZFP90 as the immunogen</p>

<p>ADSL antibody was raised in rabbit using the middle region of ADSL as the immunogen</p>

<p>DPF1 antibody was raised in rabbit using the middle region of DPF1 as the immunogen</p>

<p>Matrilin 3 antibody was raised using the N terminal of MATN3 corresponding to a region with amino acids ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADT</p>

<p>NT3 antibody was raised in rabbit using highly pure recombinant human NT-3 as the immunogen.</p>

IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE

RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH

<p>CYP3A5 antibody was raised in rabbit using the N terminal of CYP3A5 as the immunogen</p>

<p>ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL</p>

<p>Tmco3 antibody was raised in rabbit using the middle region of Tmco3 as the immunogen</p>

<p>LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS</p>

MYOZ1 antibody was raised in rabbit using the N terminal of MYOZ1 as the immunogen

CLACP antibody was raised in rabbit using residues 171-183 [NHGFLSADQQLIK] of the NC2-1 region of human and mouse CLAC-P as the immunogen.

<p>OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen</p>

<p>CKAP4 antibody was raised using the middle region of CKAP4 corresponding to a region with amino acids LRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV</p>

<p>UGT8 antibody was raised using the middle region of UGT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI</p>

<p>XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA</p>

<p>RNASE11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL</p>

<p>TFAP2C antibody was raised in rabbit using the middle region of TFAP2C as the immunogen</p>

<p>SERPINA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA</p>

<p>TRAPPC5 antibody was raised in rabbit using the N terminal of TRAPPC5 as the immunogen</p>

PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

<p>LOC732440 antibody was raised in rabbit using the C terminal of LOC732440 as the immunogen</p>

<p>Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL</p>

<p>DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF</p>

<p>VEGF antibody was raised in goat using highly pure recombinant human VEGF as the immunogen.</p>

<p>ZNF200 antibody was raised in rabbit using the middle region of ZNF200 as the immunogen</p>

<p>EGLN2 antibody was raised in rabbit using the C terminal of Egln2 as the immunogen</p>

<p>PIK3IP1 antibody was raised using the middle region of PIK3IP1 corresponding to a region with amino acids QALPAFTTEIQEASEGPGADEVQVFAPANALPARSEAAAVQPVIGISQRV</p>

<p>IFIT2 antibody was raised using the N terminal of IFIT2 corresponding to a region with amino acids SENNKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKA</p>

<p>RAD54B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT</p>

KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQ

FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK</p>

NPFFR2 antibody was raised in rabbit using the C terminal of NPFFR2 as the immunogen

The Estrogen Receptor alpha antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the estrogen receptor alpha, a protein that plays a crucial role in various cellular processes. The antibody is derived from high-quality sources and has been extensively tested for its specificity and effectiveness.

Hemopexin antibody was raised against Human Hemopexin.

<p>EAP30 antibody was raised in rabbit using the N terminal of EAP30 as the immunogen</p>

<p>KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW</p>

SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

<p>PAIP2 antibody was raised in rabbit using the N terminal of PAIP2 as the immunogen</p>

<p>Cnih antibody was raised in rabbit using the N terminal of Cnih as the immunogen</p>

<p>Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK</p>

<p>DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW</p>

PSMF1 antibody was raised in rabbit using the middle region of PSMF1 as the immunogen

GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP

<p>ZMIZ1 antibody was raised in rabbit using the N terminal of ZMIZ1 as the immunogen</p>

Purified Polyclonal EEF1G antibody

<p>ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE</p>

<p>ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA</p>

<p>STARD8 antibody was raised in rabbit using the N terminal of STARD8 as the immunogen</p>

<p>CUX2 antibody was raised in rabbit using the N terminal of CUX2 as the immunogen</p>

<p>CRTR1 antibody was raised in rabbit using residues 1-16 MLFWHTQPEHYNQHNS and 464-479 TLKAESSDGYHIILKC of the CRTR-1 protein as the immunogen.</p>

<p>The CDC25C antibody is a polyclonal antibody that specifically targets the growth factor CDC25C. It is known to play a crucial role in cell cycle regulation and is primarily located on the apical membrane of cells. The CDC25C antibody can be used in various assays and experiments to detect and measure the levels of CDC25C protein. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The CDC25C antibody has been widely used in studies related to hepatocyte growth, epidermal growth, human folate metabolism, collagen activation, and glycosylation processes. Additionally, it has been employed as an inhibitor of phosphatase activity in different experimental settings. With its high specificity and reliability, the CDC25C antibody is an essential tool for researchers studying cell cycle regulation and related pathways.</p>

<p>PCDHB16 antibody was raised in rabbit using the middle region of PCDHB16 as the immunogen</p>

<p>SERPINB2 antibody was raised in rabbit using the middle region of SERPINB2 as the immunogen</p>

<p>NRG1 antibody was raised using the middle region of NRG1 corresponding to a region with amino acids SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV</p>

<p>VMAT2 antibody was raised in rabbit using Internal sequence of the human, mouse and rat VMAT2 protein as the immunogen.</p>

<p>SERPINB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ</p>

<p>ETV3L antibody was raised in rabbit using the C terminal of ETV3L as the immunogen</p>

<p>UBXN6 antibody was raised in rabbit using the C terminal of UBXN6 as the immunogen</p>

<p>GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM</p>

<p>Cyclin E2 antibody was raised in rabbit using residues 2-15 [SRRSSRLQAKQQPQC] of the Cyclin E2 protein as the immunogen.</p>

<p>Snf8 antibody was raised in rabbit using the N terminal of Snf8 as the immunogen</p>

<p>Mouse monoclonal BRDU antibody (Prediluted for IHC)</p>

<p>Zc3h3 antibody was raised in rabbit using the N terminal of Zc3h3 as the immunogen</p>

<p>PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR</p>

<p>LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR</p>

ZNF474 antibody was raised in rabbit using the N terminal of ZNF474 as the immunogen

<p>Tgfb3 antibody was raised in rabbit using the middle region of Tgfb3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth. With its potent properties and mechanisms of action, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside offers a promising solution for combating tuberculosis infections.</p>

<p>LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL</p>

<p>CD8A antibody was raised in rabbit using the middle region of CD8A as the immunogen</p>

<p>Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen</p>

<p>PF4V1 antibody was raised using the middle region of PF4V1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE</p>

Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG

<p>TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.</p>

TOB1 antibody was raised in rabbit using the middle region of TOB1 as the immunogen

C1QTNF7 antibody was raised using the middle region of C1QTNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI

<p>CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY</p>

Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.

<p>Prohibitin antibody was raised using the C terminal of PHB corresponding to a region with amino acids AEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLS</p>

LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

<p>The NFIA antibody is a solubilized compound that acts as an affinity ligand for various medicines and test compounds. It is commonly used in assays to detect the presence of specific antibodies or autoantibodies. This antibody has been extensively studied and shown to have high specificity and sensitivity in detecting interleukin levels in isolated retinal cells. It can also be used to study the extracellular interactions of adeno-associated viruses. The NFIA antibody is a valuable tool in biomedical research and diagnostic applications.</p>

<p>FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL</p>

<p>APOL6 antibody was raised in rabbit using the middle region of APOL6 as the immunogen</p>

<p>MAPK1 antibody was raised in rabbit using the C terminal of MAPK1 as the immunogen</p>

<p>ZNF226 antibody was raised in rabbit using the N terminal of ZNF226 as the immunogen</p>

<p>VPS16 antibody was raised in rabbit using the middle region of VPS16 as the immunogen</p>

<p>PAPK antibody was raised in rabbit using residues 399-418 (SPWSELEFQFPDDKDPVWEF) of the mouse PAPK protein as the immunogen.</p>

<p>C20ORF30 antibody was raised using the C terminal Of C20Orf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD</p>

<p>Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen</p>

<p>Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT</p>

PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL

<p>CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI</p>

<p>USP30 antibody was raised in rabbit using the middle region of USP30 as the immunogen</p>

<p>IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA</p>

<p>RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS</p>

<p>SPATA12 antibody was raised in rabbit using the N terminal of SPATA12 as the immunogen</p>

<p>FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogen</p>

<p>ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen</p>

<p>Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD</p>

<p>ALDH1A2 antibody was raised in rabbit using the N terminal of ALDH1A2 as the immunogen</p>

ARMC8 antibody was raised in rabbit using the N terminal of ARMC8 as the immunogen

<p>SPOPL antibody was raised in rabbit using the N terminal of SPOPL as the immunogen</p>

<p>HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR</p>

ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG

<p>Rabbit polyclonal MUC2 antibody (Prediluted for IHC)</p>

<p>The MASH1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits the growth factor MASH1. This antibody has been extensively studied and proven to be highly effective in blocking the activity of MASH1, making it an invaluable tool for researchers studying the role of this growth factor in various biological processes.</p>

<p>RCAN2 antibody was raised in rabbit using the middle region of RCAN2 as the immunogen</p>

<p>ZNF485 antibody was raised in rabbit using the C terminal of ZNF485 as the immunogen</p>

<p>PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF</p>

<p>ORC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV</p>

<p>HSD11B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI</p>

<p>Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen</p>

<p>EGF antibody was raised in goat using highly pure recombinant murine EGF as the immunogen.</p>

<p>TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL</p>

<p>KIAA0040 antibody was raised in rabbit using the middle region of KIAA0040 as the immunogen</p>

MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK

TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI

<p>KLHL13 antibody was raised in rabbit using the N terminal of KLHL13 as the immunogen</p>

<p>ZNF488 antibody was raised in rabbit using the middle region of ZNF488 as the immunogen</p>

<p>KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE</p>

<p>AP2A1 antibody was raised in rabbit using the C terminal of AP2A1 as the immunogen</p>

<p>IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL</p>

<p>GANAB antibody was raised in rabbit using the middle region of GANAB as the immunogen</p>

OR6C75 antibody was raised using the middle region of OR6C75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS

<p>The ATF2 antibody is a highly specialized antibody that is used in Life Sciences research. It is an inhibitor of the epidermal growth factor and acts as a cytotoxic agent against specific cells. This monoclonal antibody specifically targets ATF2, a transcription factor involved in cell growth and development. The ATF2 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both a recombinant antigen and as polyclonal antibodies. The neutralizing properties of this antibody make it an essential tool for studying the role of ATF2 in cellular processes. With its high specificity and affinity to the target protein, the ATF2 antibody provides accurate and reliable results in research experiments.</p>

<p>Sdc3 antibody was raised in rabbit using the N terminal of Sdc3 as the immunogen. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL</p>

<p>CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL</p>

<p>MPG antibody was raised using the middle region of MPG corresponding to a region with amino acids QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS</p>

LCOR antibody was raised in rabbit using the middle region of LCOR as the immunogen

<p>LAX1 antibody was raised in rabbit using the C terminal of LAX1 as the immunogen</p>

<p>The Caspase 1 antibody is a highly specialized monoclonal antibody that plays a crucial role in antiviral defense mechanisms. It acts as a metal-binding protein and phosphatase, regulating cellular processes such as taurine metabolism and neutralizing the effects of growth factors. This antibody can effectively induce lysis of infected cells by targeting Caspase 1, an enzyme involved in the inflammatory response.</p>

<p>GRIN2C antibody was raised using the N terminal of GRIN2C corresponding to a region with amino acids VNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVP</p>

<p>DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogen</p>

<p>MDC antibody was raised in rabbit using highly pure recombinant murine MDC as the immunogen.</p>

SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK

<p>MIP3 alpha antibody was raised in rabbit using highly pure recombinant human MIP-3-alpha as the immunogen.</p>

<p>SERPINA5 antibody was raised using the C terminal of SERPINA5 corresponding to a region with amino acids LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL</p>

<p>MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE</p>

<p>The BAD antibody is a polyclonal antibody that targets the protein BAD. This protein plays a crucial role in regulating cell survival and apoptosis. The antibody can be used for various applications in life sciences research, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Taf6l antibody was raised in rabbit using the middle region of Taf6l as the immunogen</p>

<p>ZNF499 antibody was raised in rabbit using the middle region of ZNF499 as the immunogen</p>

<p>SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG</p>

ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM

GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS

<p>RP11-50D16.3 antibody was raised using the middle region of Rp11-50D16.3 corresponding to a region with amino acids LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL</p>

CLACP antibody was raised in rabbit using residues 155-169 [KGEQGDQGPRMVFPK] of the NC2-2 region of human and mouse CLAC-P as the immunogen.

<p>beta NGF antibody was raised in rabbit using highly pure recombinant human beta-NGF as the immunogen.</p>

<p>TWEAK antibody was raised in goat using highly pure recombinant human TWEAK as the immunogen.</p>

<p>The STING antibody is a polyclonal antibody that targets the Stimulator of Interferon Genes (STING) protein. This protein plays a crucial role in the immune response by activating the production of interferon and other cytokines. The STING antibody can be used in various life science applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>SELE antibody was raised in rabbit using the N terminal of SELE as the immunogen</p>

<p>Aldh4a1 antibody was raised in rabbit using the N terminal of Aldh4a1 as the immunogen</p>

<p>TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC</p>

ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

<p>KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA</p>

<p>Purified Polyclonal HCFC1 antibody</p>

<p>PTPN1 antibody was raised using the middle region of PTPN1 corresponding to a region with amino acids SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL</p>

<p>FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL</p>

Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY

<p>ZNF415 antibody was raised in rabbit using the C terminal of ZNF415 as the immunogen</p>

<p>Purified Polyclonal CHRNA1 antibody</p>

LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA

<p>PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ</p>

<p>ZNF625 antibody was raised in rabbit using the N terminal of ZNF625 as the immunogen</p>

<p>M-CSF antibody was raised in goat using highly pure recombinant murine M-CSF as the immunogen.</p>