Primary Antibodies

<p>Adenovirus antibody was raised in rabbit using residues 255-264 [CYYKASDGAL] of the fiber knob protein of Ad 3 as the immunogen.</p>

<p>Atg12 antibody was raised in rabbit using the C terminal of Atg12 as the immunogen</p>

<p>TIE2 antibody was raised in rabbit using an 18 amino acid peptide from human TIE2 as the immunogen.</p>

<p>TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK</p>

<p>PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT</p>

<p>CHP antibody was raised in rabbit using the N terminal of CHP as the immunogen</p>

<p>Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV</p>

<p>Purified Polyclonal Arylsulfatase D antibody</p>

Neurturin antibody was raised in rabbit using highly pure recombinant human neurturin as the immunogen.

<p>C20ORF116 antibody was raised using the N terminal Of C20Orf116 corresponding to a region with amino acids PLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDLGSRLQAQRRAQRVA</p>

<p>MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD</p>

<p>Purified Polyclonal NAB2 antibody</p>

<p>USP17L2 antibody was raised in rabbit using the middle region of USP17L2 as the immunogen</p>

<p>CEBPZ antibody was raised in rabbit using the middle region of CEBPZ as the immunogen</p>

<p>PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY</p>

<p>RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA</p>

<p>SLC37A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV</p>

<p>ZNF710 antibody was raised in rabbit using the N terminal of ZNF710 as the immunogen</p>

<p>IFN Gamma antibody was raised in rabbit using highly pure recombinant murine IFN-gamma as the immunogen.</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>

<p>ZNF319 antibody was raised in rabbit using the N terminal of ZNF319 as the immunogen</p>

<p>The TSC2 antibody is a highly effective growth factor that plays a crucial role in various Life Sciences applications. It has been extensively studied for its ability to regulate osteopontin and e-cadherin expression, making it an invaluable tool in research and experimentation. This polyclonal antibody offers exceptional hybridization capabilities, allowing for accurate detection and analysis of target proteins. Additionally, the TSC2 antibody has shown promising results in inhibiting angptl3 and anti-cd33 activity, further expanding its potential applications. With its specificity towards e-cadherin and β-catenin, this monoclonal antibody provides precise targeting for adipose-related studies. Whether you're conducting basic research or developing therapeutic interventions, the TSC2 antibody is an essential tool for any scientist looking to delve into the intricacies of cellular signaling pathways and protein interactions.</p>

<p>GRO antibody was raised in rabbit using highly pure recombinant human GRO/MGSA as the immunogen.</p>

<p>TIMP3 antibody was raised in rabbit using the N terminal of TIMP3 as the immunogen</p>

<p>ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI</p>

<p>MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY</p>

<p>MLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK</p>

<p>The Aurora A antibody is a highly effective monoclonal antibody that is used for various applications in research and diagnostics. This antibody specifically targets and neutralizes the Aurora A kinase, which plays a crucial role in cell division and mitosis. By inhibiting the activity of Aurora A, this antibody can effectively block cell division and proliferation.</p>

<p>DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC</p>

<p>RNASEH2A antibody was raised using the C terminal of RNASEH2A corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES</p>

<p>LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV</p>

<p>UBTD2 antibody was raised in rabbit using the C terminal of UBTD2 as the immunogen</p>

<p>RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE</p>

<p>Rabbit polyclonal alpha 1 Antitrypsin antibody (Prediluted for IHC)</p>

<p>Kidins220 antibody was raised in rabbit using residues 1747-1762 [ASSESTGFGEERESIL] of the human 220kDa Kidins220 protein as the immunogen.</p>

<p>IKZF2 antibody was raised in rabbit using the middle region of IKZF2 as the immunogen</p>

<p>PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ</p>

<p>FAM79B antibody was raised in rabbit using the C terminal of FAM79B as the immunogen</p>

<p>Leptin antibody was raised in rabbit using highly pure recombinant human leptin as the immunogen.</p>

<p>TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV</p>

<p>TCEAL2 antibody was raised in rabbit using the N terminal of TCEAL2 as the immunogen</p>

<p>GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV</p>

<p>CLCA2 antibody was raised in rabbit using the C terminal of CLCA2 as the immunogen</p>

<p>FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI</p>

<p>DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG</p>

<p>CDKL3 antibody is a monoclonal antibody that targets the CDKL3 protein, which is involved in various growth factor signaling pathways. It has been extensively studied in the field of Life Sciences and has shown promising results. The CDKL3 antibody specifically binds to the amino-terminal region of the CDKL3 protein and inhibits its activity.</p>

<p>NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS</p>

<p>ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogen</p>

<p>RIPX antibody was raised in rabbit using the C terminal of RIPX as the immunogen</p>

<p>TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD</p>

<p>Collagen Type XI Alpha 2 antibody was raised using the N terminal of COL11A2 corresponding to a region with amino acids TADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSG</p>

<p>Rabbit polyclonal P38 MAPK antibody (Thr179)</p>

<p>PTX3 antibody was raised in rabbit using the N terminal of PTX3 as the immunogen</p>

<p>LOC391766 antibody was raised in rabbit using the middle region of LOC391766 as the immunogen</p>

<p>FCRLA antibody was raised using the middle region of FCRLA corresponding to a region with amino acids PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH</p>

<p>Purified Polyclonal 14 3 3 eta antibody</p>

<p>SKAP1 antibody was raised using the N terminal of SKAP1 corresponding to a region with amino acids RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>

<p>CFP antibody was raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE</p>

<p>Purified Polyclonal CD143 antibody</p>

<p>MARS antibody was raised in rabbit using the middle region of MARS as the immunogen</p>

<p>C11ORF24 antibody was raised using the N terminal Of C11Orf24 corresponding to a region with amino acids SPVTLTKGTSAAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAV</p>

<p>NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG</p>

<p>SOX17 antibody was raised in rabbit using the middle region of SOX17 as the immunogen</p>

<p>CD7 antibody was raised in rabbit using the middle region of CD7 as the immunogen</p>

<p>SNAP29 antibody was raised in rabbit using the middle region of SNAP29 as the immunogen</p>

<p>CASP10 antibody was raised in rabbit using the middle region of CASP10 as the immunogen</p>

<p>Mouse monoclonal Cytokeratin AE3 antibody (Prediluted for IHC)</p>

<p>TCEAL3 antibody was raised in rabbit using the N terminal of TCEAL3 as the immunogen</p>

<p>Ttbk2 antibody was raised in rabbit using the N terminal of Ttbk2 as the immunogen</p>

<p>DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK</p>

<p>ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE</p>

<p>SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR</p>

<p>Rabbit polyclonal Lambda light chain antibody (Prediluted for IHC)</p>

<p>LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF</p>

<p>GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF</p>

<p>Pde4d antibody was raised in rabbit using the N terminal of Pde4d as the immunogen</p>

<p>Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET</p>

<p>NUP155 antibody was raised in rabbit using the N terminal of NUP155 as the immunogen</p>

<p>OR2T1 antibody was raised in rabbit using the C terminal of OR2T1 as the immunogen</p>

<p>FKBP8 antibody was raised using the C terminal of FKBP8 corresponding to a region with amino acids AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL</p>

<p>Purified Rabbit CRP antibody</p>

<p>ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen</p>

<p>KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH</p>

<p>PDHA2 antibody was raised in rabbit using the N terminal of PDHA2 as the immunogen</p>

<p>PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ</p>

<p>MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK</p>

<p>LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH</p>

<p>ZNF90 antibody was raised in rabbit using the N terminal of ZNF90 as the immunogen</p>

<p>Exodus 2 antibody was raised in rabbit using highly pure recombinant human exodus-2 as the immunogen.</p>

<p>CD8A antibody was raised in rabbit using the middle region of CD8A as the immunogen</p>

<p>Purified Polyclonal DUSP1/4 antibody</p>

<p>RSV antibody was raised in rabbit using whole RSV virions (subgroup A-Long strain) as the immunogen.</p>

<p>Dtx3 antibody was raised in rabbit using the C terminal of Dtx3 as the immunogen</p>

<p>SLC25A19 antibody was raised in rabbit using the middle region of SLC25A19 as the immunogen</p>

<p>UNCX antibody was raised in rabbit using the N terminal of UNCX as the immunogen</p>

<p>GRHL3 antibody was raised in rabbit using the C terminal of GRHL3 as the immunogen</p>

<p>Rabbit polyclonal CEA antibody (Prediluted for IHC)</p>

<p>Abo antibody was raised in rabbit using the middle region of Abo as the immunogen</p>

<p>CLEC4G antibody was raised using the N terminal of CLEC4G corresponding to a region with amino acids RTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE</p>

<p>FGF9 antibody was raised in rabbit using highly pure recombinant murine FGF-9 as the immunogen.</p>

<p>CYP2A7 antibody was raised using the middle region of CYP2A7 corresponding to a region with amino acids KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI</p>

<p>SCF antibody was raised in goat using highly pure recombinant human SCF as the immunogen.</p>

<p>ZCCHC3 antibody was raised in rabbit using the middle region of ZCCHC3 as the immunogen</p>

<p>C1QB antibody was raised using the C terminal of C1QB corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD</p>

<p>Cardiotrophin 1 antibody was raised in rabbit using highly purerecombinant hCT-1 (human Cardiotrophin-1) as the immunogen.</p>

<p>IL13 antibody was raised in rabbit using highly pure recombinant murine IL-13 as the immunogen.</p>

<p>Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen</p>

<p>MCTS1 antibody was raised using the N terminal of MCTS1 corresponding to a region with amino acids MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV</p>

<p>GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI</p>

<p>SLC17A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS</p>

<p>ZNF280A antibody was raised in rabbit using the C terminal of ZNF280A as the immunogen</p>

<p>CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen</p>

<p>CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW</p>

<p>RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA</p>

<p>WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG</p>

<p>OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen</p>

<p>Tmem132d antibody was raised in rabbit using the middle region of Tmem132d as the immunogen</p>

<p>Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>Gpr88 antibody was raised in rabbit using the C terminal of Gpr88 as the immunogen</p>

<p>E2F8 antibody was raised in rabbit using the middle region of E2F8 as the immunogen</p>

<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV</p>

<p>TUT1 antibody was raised in rabbit using the N terminal of TUT1 as the immunogen</p>

<p>MAPK6 antibody was raised in rabbit using the middle region of MAPK6 as the immunogen</p>

<p>Purified Polyclonal Connexin 37 antibody</p>

<p>CYP20A1 antibody was raised using the N terminal of CYP20A1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV</p>

<p>SMYD5 antibody was raised in rabbit using the C terminal of SMYD5 as the immunogen</p>

<p>GRK7 antibody was raised in rabbit using the C terminal of GRK7 as the immunogen</p>

<p>BIN2 antibody was raised in rabbit using the middle region of BIN2 as the immunogen</p>

<p>ZDHHC19 antibody was raised using the middle region of ZDHHC19 corresponding to a region with amino acids AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLT</p>

<p>Human Albumin antibody was raised against Human Albumin.</p>

<p>Vaspin antibody was raised in rabbit using highly pure recombinant human vaspin as the immunogen.</p>

<p>GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG</p>

<p>CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA</p>

<p>EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG</p>

<p>PREB antibody was raised in rabbit using the N terminal of PREB as the immunogen</p>

<p>PYHIN1 antibody was raised in rabbit using the N terminal of PYHIN1 as the immunogen</p>

<p>KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL</p>

<p>TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV</p>

<p>The SP1 antibody is a monoclonal antibody that is commonly used in Life Sciences research. It specifically targets and binds to the SP1 protein, which is a transcription factor involved in regulating gene expression. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting SP1 protein in various experimental settings.</p>

<p>MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA</p>

<p>Atp5f1 antibody was raised in rabbit using the N terminal of Atp5f1 as the immunogen</p>

<p>DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY</p>

<p>Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG</p>

<p>KRT3 antibody was raised in rabbit using the C terminal of KRT3 as the immunogen</p>

YWHAB antibody was raised in rabbit using the middle region of YWHAB as the immunogen

<p>The NF kappaB p65 antibody is a highly effective tool used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody specifically targets the NF kappaB p65 protein, which plays a crucial role in various cellular processes.</p>

<p>TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH</p>

<p>Zfy2 antibody was raised in rabbit using the middle region of Zfy2 as the immunogen</p>

<p>CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids RIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPL</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRP</p>

<p>ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL</p>

<p>HNMT antibody was raised in rabbit using the N terminal of HNMT as the immunogen</p>

<p>IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ</p>

<p>SLC22A15 antibody was raised using the middle region of SLC22A15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK</p>

<p>Purified Polyclonal SHPTP2 antibody</p>

<p>ZNF570 antibody was raised in rabbit using the N terminal of ZNF570 as the immunogen</p>

<p>ZRANB1 antibody was raised in rabbit using the C terminal of ZRANB1 as the immunogen</p>

<p>MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA</p>

<p>TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV</p>

<p>ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML</p>

<p>MDS032 antibody was raised in rabbit using the N terminal of MDS032 as the immunogen</p>

<p>ST3GAL3 antibody was raised using the N terminal of ST3GAL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK</p>

<p>SNRPN antibody was raised in rabbit using the N terminal of SNRPN as the immunogen</p>

<p>BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY</p>

<p>AFM antibody was raised in rabbit using the C terminal of AFM as the immunogen</p>

<p>PHYH antibody was raised in rabbit using the N terminal of PHYH as the immunogen</p>

<p>MAPK1 antibody was raised in rabbit using the middle region of MAPK1 as the immunogen</p>

<p>BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR</p>

<p>SLC6A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE</p>

<p>HLTF antibody was raised in rabbit using the N terminal of HLTF as the immunogen</p>

<p>VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT</p>

<p>Purified Polyclonal Alpha fetoglobulin antibody</p>