Primary Antibodies

<p>TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>Rabbit polyclonal PRDM12 antibody</p>

<p>Rabbit polyclonal RSU1 antibody</p>

<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogen</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>NAT8 antibody was raised in Rabbit using Human NAT8 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>NFYA antibody was raised in Rabbit using Human NFYA as the immunogen</p>

<p>Rabbit polyclonal SLC12A4 antibody</p>

<p>LSM4 antibody was raised in Rabbit using Human LSM4 as the immunogen</p>

<p>Rabbit polyclonal LAMB1 antibody</p>

<p>Rabbit Polyclonal eIF2 alpha antibody (Ser49)</p>

<p>Mouse monoclonal FBXO21 antibody</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>The NANP antibody is a monoclonal antibody that targets myostatin, a protein involved in muscle growth regulation. This antibody specifically binds to myostatin and inhibits its activity, leading to increased muscle mass and strength. In addition to its effects on myostatin, the NANP antibody has been shown to interact with other proteins such as elastase and lipoprotein lipase. These interactions may have implications for various biological processes, including fibrinogen metabolism and lipid metabolism. The NANP antibody is widely used in life sciences research and has applications in areas such as drug discovery, diagnostics, and therapeutics. Its specificity and high affinity make it a valuable tool for studying the role of myostatin in muscle development and disease.</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>INSR antibody was raised in Rabbit using Human INSR as the immunogen</p>

<p>Rabbit polyclonal PFDN4 antibody</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

<p>Mouse monoclonal UBOX5 antibody</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>Purified Polyclonal DNAJB11 antibody</p>

<p>The DCT antibody is a polyclonal antibody that specifically targets actin filaments. It is commonly used in Life Sciences research to study the activation and function of actin in various cellular processes. This antibody can be used for immunostaining, Western blotting, and other experimental techniques to visualize and quantify actin levels in cells and tissues.</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>4EBP1 antibody was raised in Mouse using a purified recombinant fragment of 4EBP1 expressed in E. coli as the immunogen.</p>

<p>Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>Rabbit polyclonal ZNHIT1 antibody</p>

<p>Rabbit polyclonal ROBO3 antibody</p>

<p>Affinity Purified Donkey anti-Sheep IgG h+l Antibody</p>

<p>anti-C-Myc Antibody</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>The CYP2J2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that specifically targets the CYP2J2 enzyme, which plays a crucial role in the metabolism of arachidonic acid. This antibody has high bioavailability and can effectively neutralize the activity of CYP2J2.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>Affinity Purified Goat anti-Chicken IgY Fc Antibody. Please inquire for bulk pricing or custom conjugations.</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>Monoclonal Mouse anti-FLAG-Tag (TM) Antibody recognizes N-terminal, C-terminal or internal DYKDDDDK-tagged fusion proteins. Validated for use in Western Blot and ELISA assays.</p>

<p>Rabbit polyclonal APBB1IP antibody</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>

<p>Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Goat anti-Dog CRP antibody can be used in a variety of immunoassays that require the specific detection of canine CRP.</p>

<p>anti-Dog IgE Antibody</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>The Cortactin antibody is a highly specialized monoclonal antibody that targets and binds to Cortactin, a protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research related to adipose tissue, epidermal growth factor signaling, and even the pathogenesis of certain diseases such as amyloid plaque formation.</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>Please enquire for more information about Affinity Purified anti-V5 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Mouse anti-Cat IgE Antibody</p>

<p>Rabbit polyclonal RRAS antibody</p>

<p>Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Rabbit anti-rat IgG (H+L) (FITC) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>

<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>

<p>LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ZNF264 antibody was raised in rabbit using the C terminal of ZNF264 as the immunogen</p>

<p>Anti-Human CD25 Monoclonal Antibody</p>

<p>Purified Mouse anti-Human IgG (gamma chain specific) Monoclonal Antibody</p>

<p>Goats were immunized with highly purified cat IgG h+l and the resulting antiserum was collected. Specific antibody was immunoaffinity purified off a cat IgG containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.4 equals 1.0 mg of IgG.<br>This antibody will react with cat IgG and with light chains common with other cat immunoglobulins as determined by ELISA and IEP techniques. It is suitable for blotting, ELISA, IHC and Lateral Flow applications. This antibody may crossreact with IgG from other species. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Purified Rabbit polyclonal p53 antibody (Ser392)</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>

<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>

<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>

<p>The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.</p>

<p>Human Haptoglobin Reference Serum</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Rabbit polyclonal NRSN2 antibody</p>