Primary Antibodies

<p>CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW</p>

<p>DPYSL3 antibody was raised in Rabbit using Human DPYSL3 as the immunogen</p>

<p>AKR1C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK</p>

<p>Nesprin 1 Monoclonal Antibody</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant rat MIP1 alpha as the immunogen.</p>

<p>COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>Rabbit polyclonal PLAU antibody (FITC)</p>

<p>The PCNA antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets proliferating cell nuclear antigen (PCNA), which plays a crucial role in DNA replication and repair. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>ZNF791 antibody was raised in rabbit using the middle region of ZNF791 as the immunogen</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Purified Polyclonal RAB35 antibody</p>

<p>KCNJ1 antibody was raised using the middle region of KCNJ1 corresponding to a region with amino acids LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP</p>

<p>Rabbit polyclonal Cyclin D3 antibody (Thr283)</p>

<p>COG1 antibody was raised in Rabbit using Human COG1 as the immunogen</p>

<p>The BMX antibody is a powerful tool for researchers in the field of molecular biology. It is an antibody that specifically targets and binds to the BMX protein, a member of the tyrosine kinase family. This antibody can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>FGD1 antibody was raised in rabbit using the N terminal of FGD1 as the immunogen</p>

<p>The NF1 antibody is a polyclonal antibody that specifically targets the NF1 protein. This protein plays a crucial role in regulating cell growth and division, as well as in controlling the development of tumors. The NF1 antibody is widely used in life sciences research to study the function and activity of the NF1 protein.</p>

<p>Fank1 antibody was raised in rabbit using the middle region of Fank1 as the immunogen</p>

<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA</p>

<p>The STAT3 antibody is a highly specialized protein complex that specifically targets and neutralizes the activated form of the STAT3 protein. It is available in both polyclonal and monoclonal antibody forms, providing researchers with options for their specific experimental needs.</p>

<p>LDHA antibody was raised using the middle region of LDHA corresponding to a region with amino acids PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH</p>

<p>Rabbit polyclonal COX5B antibody</p>

<p>The PAK2 antibody is a monoclonal antibody that has antiviral properties. It specifically targets and binds to PAK2, a protein involved in various cellular processes such as cell migration, proliferation, and survival. This antibody can be used for research purposes in the field of Life Sciences to study the role of PAK2 in different biological pathways.</p>

<p>Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH</p>

<p>The EDG6 antibody is a highly specialized inhibitor that targets serine protease activity. It has been extensively tested and proven to effectively neutralize the function of this enzyme. This polyclonal antibody is derived from human serum and can be used in various applications, including nuclear extracts and spectrometric analysis.</p>

<p>OR1S1 antibody was raised in rabbit using the C terminal of OR1S1 as the immunogen</p>

<p>Mouse monoclonal ASCC1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits bactericidal activity against mycobacterium strains. It achieves this by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal Tuberin antibody (Thr1462)</p>

<p>The CD326 antibody is a monoclonal antibody that specifically targets the epidermal growth factor protein. It is commonly used in Life Sciences research to study the role of this protein in various cellular processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Ppp2r2d antibody was raised in rabbit using the C terminal of Ppp2r2d as the immunogen</p>

<p>TRIM17 antibody was raised in rabbit using the middle region of TRIM17 as the immunogen</p>

<p>Rabbit polyclonal NMDAR2A antibody</p>

<p>Rabbit polyclonal Annexin A2 antibody (FITC)</p>

<p>DHX38 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 38 (Dhx38)</p>

<p>Rabbit polyclonal PP1 alpha antibody</p>

<p>EIF3C antibody was raised in Rabbit using Human EIF3C as the immunogen</p>

<p>The NOX4 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It belongs to the group of antibodies that are specifically designed to target and inhibit NOX4, an enzyme involved in the production of reactive oxygen species (ROS). This antibody has been shown to effectively block the activity of NOX4, making it an important tool for studying the role of this enzyme in various biological processes.</p>

<p>ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK</p>

<p>ARPC2 antibody was raised in Rabbit using Human ARPC2 as the immunogen</p>

<p>NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>The MERTK antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the MERTK protein, which plays a crucial role in various cellular processes. This antibody is widely used in studies related to collagen, blood plasma, interferon, and platelet-derived growth factor-bb.</p>

<p>Aquaporin 5 antibody is a polyclonal antibody that specifically targets the Aquaporin 5 protein. Aquaporins are a family of integral membrane proteins that facilitate the transport of water across cell membranes. Aquaporin 5 is primarily found in the salivary glands, lungs, and lacrimal glands, where it plays a crucial role in regulating fluid secretion.</p>

<p>Rabbit polyclonal ENAC alpha antibody (Thr615)</p>

<p>Purified Polyclonal Fibulin 4 antibody</p>

<p>Mouse monoclonal LAYN antibody</p>

<p>Purified Polyclonal ZO3 antibody</p>

<p>SLC10A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLG</p>

<p>Rabbit polyclonal EPHB6 antibody</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>Rabbit polyclonal BAZ2A antibody</p>

<p>Rabbit polyclonal SGK3 antibody</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>Rabbit polyclonal CD225 antibody (biotin)</p>

<p>The CD171 antibody is a monoclonal antibody that specifically targets the alpha-synuclein antigen. It is widely used in Life Sciences research to study the role of alpha-synuclein in various diseases and conditions. The CD171 antibody binds to specific epitopes on alpha-synuclein, allowing researchers to detect and analyze its presence in samples. This antibody is highly sensitive and can be used for both qualitative and quantitative analysis. Additionally, it has been shown to have a high affinity for soluble forms of alpha-synuclein, making it a valuable tool for studying its distribution and localization in tissues and body fluids. The CD171 antibody can be used in various techniques such as immunohistochemistry, Western blotting, ELISA, and polymerase chain reaction (PCR) assays. Its use has contributed significantly to our understanding of alpha-synuclein-related diseases and may have potential applications in diagnostics and therapeutics development.</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>Rabbit polyclonal QORX antibody</p>

<p>KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT</p>

<p>CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS</p>

<p>C16ORF58 antibody was raised using the N terminal Of C16Orf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>HAVCR2 antibody was raised in rabbit using the C terminal of HAVCR2 as the immunogen</p>

<p>Purified Polyclonal AKAP13 antibody</p>

<p>Gnpda1 antibody was raised in rabbit using the N terminal of Gnpda1 as the immunogen</p>

<p>CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell surface protein found on various immune cells. This antibody can be used in immunohistochemistry and flow cytometry to detect and quantify CD56 expression. It is commonly used in research and diagnostic applications related to the study of immune cell function and diseases such as cancer. CD56 antibody works by binding to the CD56 protein, allowing for visualization and analysis of CD56-positive cells. It is highly specific and sensitive, making it a valuable tool in life sciences research.</p>

<p>ZNF131 antibody was raised in rabbit using the N terminal of ZNF131 as the immunogen</p>

<p>Purified Polyclonal FXR2 antibody</p>

<p>Purified Rabbit polyclonal PLD1 antibody (Thr147)</p>

<p>POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ</p>

<p>FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids YTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWG</p>

<p>Rabbit Polyclonal Progesterone Receptor antibody (Ser190)</p>

<p>ZNF580 antibody was raised in rabbit using the N terminal of ZNF580 as the immunogen</p>

<p>Neurocan Monoclonal Antibody</p>

<p>Rabbit polyclonal TBCA antibody</p>

<p>POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES</p>

<p>HOM-TES-103 antibody was raised in rabbit using the C terminal of HOM-TES-103 as the immunogen</p>

<p>C1ORF131 antibody was raised using the middle region of C1Orf131 corresponding to a region with amino acids TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV</p>

<p>Rabbit polyclonal PRDM12 antibody</p>

<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV</p>

<p>TRIM5 alpha antibody was raised in Mouse using a purified recombinant fragment of human TRIM5 alpha expressed in E. coli as the immunogen.</p>

<p>PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>Rabbit polyclonal Histone H3 antibody (Thr11)</p>

<p>Rabbit polyclonal ERH antibody (biotin)</p>

<p>Rabbit polyclonal SORD antibody</p>

<p>Purified Polyclonal B4GALT3 antibody</p>

<p>Rabbit polyclonal ARMX3 antibody</p>

<p>Purified Polyclonal CD246 antibody</p>

<p>PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR</p>

<p>Purified Polyclonal Von Hippel Lindau antibody</p>

<p>IgG2a Negative Control Monoclonal Antibody</p>

<p>Rabbit polyclonal FRS2 antibody (Tyr436)</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>Mouse monoclonal CXorf26 antibody</p>

<p>RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS</p>

<p>Rabbit polyclonal CK2 beta antibody (Ser209)</p>

<p>MIF antibody was raised in rabbit using the middle region of MIF as the immunogen</p>

<p>Rabbit polyclonal MRLCL2 antibody</p>

<p>Purified Polyclonal SYNE3 antibody</p>

<p>The Caspase 3 antibody is a powerful tool used in Life Sciences research for the detection and analysis of caspase activity. Caspases are enzymes involved in programmed cell death, also known as apoptosis. This antibody specifically recognizes and binds to activated caspase 3, allowing researchers to study the process of apoptosis in various biological systems.</p>

<p>HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE</p>

<p>The ITCH antibody is a powerful tool in the field of immunology and cancer research. It is a polyclonal antibody that specifically targets the ITCH protein, which plays a crucial role in various cellular processes. The ITCH antibody has been extensively studied for its ability to inhibit the activity of carbonyl reductase, an enzyme involved in drug metabolism.</p>

<p>Rabbit Polyclonal CPB2 antibody</p>

<p>This HRP Conjugated Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as the detection antibody in various immunoassays.</p>

<p>ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL</p>

<p>The Elk1 antibody is a biomolecule that specifically targets the Elk1 protein, making it an essential tool in life sciences research. This polyclonal antibody recognizes the glycoprotein Elk1, which plays a crucial role in various cellular processes. It is involved in gene transcription and acts as a transcription factor that regulates the expression of genes involved in cell proliferation, differentiation, and survival.</p>

<p>Arsb antibody was raised in rabbit using the middle region of Arsb as the immunogen</p>

<p>Rabbit polyclonal RPL3 antibody</p>

<p>Rabbit polyclonal NFKP p65 antibody (Ser311)</p>

<p>The DGAT2 antibody is a highly specific and sensitive polyclonal antibody that targets the antigen DGAT2. It is commonly used in life sciences research to study atypical hemolytic disorders and autoimmune diseases. The DGAT2 antibody binds to actin filaments and can be used in various applications, such as immunohistochemistry and western blotting. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. The DGAT2 antibody has also been used in studies involving human albumin and nuclear inhibitors, further highlighting its versatility in different research areas. With its high quality and reliability, the DGAT2 antibody is an essential tool for scientists looking to explore the functions of this important protein.</p>

<p>ZNF589 antibody was raised in rabbit using the middle region of ZNF589 as the immunogen</p>

<p>MSI1 antibody was raised in rabbit using residues 5-21 [APQPGLASPDSPHDPCK] of the human mushashi protein as the immunogen.</p>

<p>Rabbit polyclonal Paxillin antibody (Ser272)</p>

<p>CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA</p>

<p>Purified Rabbit polyclonal MKK1 antibody</p>

<p>The Lck antibody is a highly specific monoclonal antibody that targets the Lck protein, a tyrosine kinase involved in T-cell signaling. It is commonly used in research and diagnostic applications to study the role of Lck in various cellular processes. The Lck antibody recognizes a specific epitope on the Lck protein and can be used for immunoprecipitation, Western blotting, flow cytometry, and immunofluorescence experiments. This antibody has been extensively validated and shown to have high specificity and sensitivity. It is available as both a monoclonal antibody and a polyclonal antibody, allowing researchers to choose the best option for their specific needs. Whether you are studying T-cell activation, immune response, or signal transduction pathways, the Lck antibody is an essential tool for your research. Trust in its quality and reliability to advance your understanding of cellular biology.</p>

<p>Rabbit polyclonal PKC epsilon antibody (Ser729)</p>

<p>HRP Conjugated Chicken anti-Protein G (streptococcal) Antibody</p>

<p>Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF</p>

<p>The CDK2 antibody is a highly specialized monoclonal antibody that targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody is widely used in life sciences research to study the role of CDK2 in various cellular processes.</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>