Primary Antibodies

<p>Goat anti Human IgE antibody</p>

<p>SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF</p>

<p>SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>The PARP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activity of the poly (ADP-ribose) polymerase 2 (PARP2) protein. This antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Purified Polyclonal RAB35 antibody</p>

<p>Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF</p>

<p>ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND</p>

<p>Purified Rabbit polyclonal OR51F2 antibody</p>

<p>Rabbit polyclonal PP1 alpha antibody</p>

<p>The STAT5A antibody is a powerful tool in the field of Life Sciences. It specifically targets and detects the STAT5A protein, which plays a crucial role in various cellular processes. This antibody is highly specific and can be used for a range of applications including immunohistochemistry, Western blotting, and ELISA.</p>

<p>SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids  DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY</p>

<p>DPYSL3 antibody was raised in Rabbit using Human DPYSL3 as the immunogen</p>

<p>The FOXO4 antibody is a monoclonal antibody that specifically targets the protease FOXO4. This protease plays a crucial role in extracellular processes and has been implicated in various diseases. The FOXO4 antibody binds to the protease, inhibiting its activity and preventing it from carrying out its normal functions.</p>

<p>Rabbit polyclonal ERH antibody (biotin)</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>

<p>COG1 antibody was raised in Rabbit using Human COG1 as the immunogen</p>

<p>CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK</p>

<p>The CD326 antibody is a monoclonal antibody that specifically targets the epidermal growth factor protein. It is commonly used in Life Sciences research to study the role of this protein in various cellular processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Rabbit polyclonal SFRS17A antibody</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>The LATS antibody is a polyclonal antibody that is used in life sciences research. It specifically targets alpha-fetoprotein, telomerase, chemokines, brain natriuretic peptide, and growth factor-1 receptor. This antibody is widely used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to be highly specific and sensitive in detecting its target proteins in human serum samples. The LATS antibody can be used to study the role of these proteins in various physiological processes and diseases. With its high-quality performance and reliable results, this antibody is an essential tool for researchers in the field of life sciences.</p>

<p>Purified Rabbit polyclonal eEF1 alpha antibody</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.</p>

<p>Mouse monoclonal ASCC1 antibody</p>

<p>ZNF707 antibody was raised in rabbit using the N terminal of ZNF707 as the immunogen</p>

<p>SLC24A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS</p>

<p>SLC1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI</p>

<p>The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.</p>

<p>PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP</p>

<p>The NCOA4 antibody is a highly specialized polyclonal antibody that targets a specific antigen. It can be used in various applications, including research in the field of Life Sciences, development of vaccines, and production of monoclonal antibodies. This antibody has shown promising results in the treatment of various diseases, including cancer. It has been found to have anticancer properties and can be used as a potential therapeutic agent. Additionally, the NCOA4 antibody has been studied for its ability to inhibit retinoid metabolism, making it a valuable tool in the development of retinoid-based medicines. Its unique mechanism of action involves targeting specific molecules such as β-catenin and HDAC inhibitor, which are known to play crucial roles in disease progression. With its wide range of applications and potential therapeutic benefits, the NCOA4 antibody is a valuable asset in the field of biomedical research and drug discovery.</p>

<p>Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Rabbit polyclonal RCL antibody</p>

<p>The Caspase 3 antibody is a highly effective growth factor that is commonly used in Life Sciences research. It is known for its ability to detect and neutralize active agents that can cause cell death. This antibody specifically targets caspase 3, a key enzyme involved in apoptosis. By binding to caspase 3, the antibody inhibits its activity and prevents cell death from occurring.</p>

<p>Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI</p>

<p>Rabbit polyclonal Tau antibody (Thr205)</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Purified Polyclonal AMPK beta 1 antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Rabbit polyclonal OR6S1 antibody</p>

<p>Purified Polyclonal CLCN7 antibody</p>

<p>The MTHFR antibody is a powerful tool used in various immunoassays and research applications. It specifically targets the methylenetetrahydrofolate reductase (MTHFR) enzyme, which plays a crucial role in dopamine metabolism and cytochrome P450 oxidoreductase activity. This monoclonal antibody is derived from a hybridoma cell line and exhibits high specificity and affinity for MTHFR.</p>

<p>HAND2 antibody was raised in mouse using recombinant Human Heart And Neural Crest Derivatives Expressed 2 (Hand2)</p>

<p>The NMDAR2B antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the NMDA receptor subunit 2B (NMDAR2B), which plays a crucial role in neuronal function and synaptic plasticity. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE</p>

<p>Purified Polyclonal Cytochrome P450 3A4 antibody</p>

<p>Purified Polyclonal CYP11B1 antibody</p>

<p>VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT</p>

<p>Rabbit polyclonal TMEM30C antibody</p>

<p>SIRT4 antibody was raised in rabbit using the N terminal of SIRT4 as the immunogen</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>The ERCC1 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It is designed to specifically target and neutralize the alpha-fetoprotein, which is a protein associated with certain types of cancer. The antibody works by binding to the alpha-fetoprotein, preventing its interaction with other proteins and inhibiting its function.</p>

<p>The GATA3 antibody is a highly specific and potent monoclonal antibody that targets the GATA3 protein. This protein is involved in various cellular processes, including the regulation of gene expression and cell differentiation. The GATA3 antibody has been extensively studied for its role in cancer research, particularly in breast cancer.</p>

<p>Rabbit polyclonal LAMB1 antibody</p>

<p>Please enquire for more information about Affinity Purified anti-V5 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>Rabbit polyclonal RPC3 antibody</p>

<p>Ku80 antibody was raised in rabbit using residues 419-440 [LVYVQLPFMEDLRQYMFSSLKN] of the 80 kDa Ku80 protein as the immunogen.</p>

<p>The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.</p>

<p>CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS</p>

<p>RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL</p>

<p>Rabbit polyclonal OSR1 antibody (Thr185)</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Rabbit Polyclonal ABL1/2 antibody (Tyr393/429)</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Purified Polyclonal CDC25B antibody</p>

<p>The GAP43 antibody is a highly specialized monoclonal antibody that is used in various research applications. It is commonly used as an electrode inhibitor and has been shown to be effective in immobilizing specific proteins for further analysis. This antibody is also useful in the field of diuretic research, where it has been shown to have a reactive effect on human serum. Additionally, the GAP43 antibody has demonstrated neutralizing properties against interleukin-6, making it a valuable tool in immunological studies. Furthermore, this antibody has been found to be effective in the study of mesenchymal stem cells and their reactive oxygen species production. With its wide range of applications and proven effectiveness, the GAP43 antibody is a valuable asset for any researcher in need of reliable and accurate results.</p>

<p>Sec11c antibody was raised in rabbit using the C terminal of Sec11c as the immunogen</p>

<p>IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE</p>

<p>Sbk1 antibody was raised in rabbit using the C terminal of Sbk1 as the immunogen</p>

<p>FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF</p>

<p>Cytokeratin 5 antibody is a high-quality monoclonal antibody that specifically targets the apical membrane protein phosphatase. It plays a crucial role in regulating cell growth and differentiation by binding to tyrosine residues on epidermal growth factor receptors. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR</p>

<p>Purified Rabbit polyclonal Desmin antibody (Ser60)</p>

<p>Ankrd13d antibody was raised in rabbit using the middle region of Ankrd13d as the immunogen</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>FXYD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG</p>

<p>Ppp2r5e antibody was raised in rabbit using the N terminal of Ppp2r5e as the immunogen</p>

<p>Rabbit polyclonal PRDM12 antibody</p>

<p>MCP1 antibody was raised in rabbit using highly pure recombinant rat MCP-1(MCAF) as the immunogen.</p>

<p>Rabbit polyclonal APBB1IP antibody</p>

<p>RP13-102H20.1 antibody was raised using the middle region of RP13-102H20.1 corresponding to a region with amino acids EDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGA</p>

<p>Purified Polyclonal FGF5 antibody</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>anti-Dog IgE Antibody</p>

<p>Aquaporin 5 antibody is a polyclonal antibody that specifically targets the Aquaporin 5 protein. Aquaporins are a family of integral membrane proteins that facilitate the transport of water across cell membranes. Aquaporin 5 is primarily found in the salivary glands, lungs, and lacrimal glands, where it plays a crucial role in regulating fluid secretion.</p>

<p>Rabbit polyclonal AOS1 antibody</p>

<p>The NF1 antibody is a polyclonal antibody that specifically targets the NF1 protein. This protein plays a crucial role in regulating cell growth and division, as well as in controlling the development of tumors. The NF1 antibody is widely used in life sciences research to study the function and activity of the NF1 protein.</p>

<p>MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE</p>

<p>The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>The STAT3 antibody is a highly specialized protein complex that specifically targets and neutralizes the activated form of the STAT3 protein. It is available in both polyclonal and monoclonal antibody forms, providing researchers with options for their specific experimental needs.</p>

<p>Purified Rabbit polyclonal CD32 antibody (Tyr292)</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>Rabbit polyclonal EPHB6 antibody</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD</p>

<p>Arsb antibody was raised in rabbit using the middle region of Arsb as the immunogen</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal KCNMB2 antibody</p>

<p>ZBTB40 antibody was raised in rabbit using the N terminal of ZBTB40 as the immunogen</p>

<p>Purified Polyclonal ZIP9 antibody</p>

<p>LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE</p>

<p>TACI antibody was raised in goat using highly pure recombinant human TACI as the immunogen.</p>

<p>The FGFR4 antibody is a highly specialized chemotherapy agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is known for its toxic effects on targeted cells. This antibody specifically targets growth factor receptors, inhibiting their activity and preventing cell proliferation. It can be used as a monoclonal antibody or in combination with other inhibitors or sequestrants to enhance its therapeutic effects. The FGFR4 antibody has been extensively studied as a test substance in various research studies, demonstrating its efficacy in blocking the extracellular signaling pathways involved in cell growth and development. Its unique ability to bind to specific polynucleotides makes it an excellent inhibitor for targeted therapy.</p>

<p>RANK receptor antibody was raised in rabbit using highly pure recombinant human sRANK Receptor as the immunogen.</p>

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>Purified Polyclonal CD246 antibody</p>

<p>Rabbit polyclonal Mucin 14 antibody</p>