Primary Antibodies

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>Rabbit polyclonal RRAS antibody</p>

<p>LDLRAD1 antibody was raised in Rabbit using Human LDLRAD1 as the immunogen</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Rabbit polyclonal SERPINB8 antibody</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Purified Mouse anti-Cat IgE Antibody</p>

<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.</p>

<p>Goats were immunized with highly purified cat IgG h+l and the resulting antiserum was collected. Specific antibody was immunoaffinity purified off a cat IgG containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.4 equals 1.0 mg of IgG.<br>This antibody will react with cat IgG and with light chains common with other cat immunoglobulins as determined by ELISA and IEP techniques. It is suitable for blotting, ELISA, IHC and Lateral Flow applications. This antibody may crossreact with IgG from other species. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>anti-C-Myc Antibody</p>

<p>This Goat anti-Dog CRP antibody can be used in a variety of immunoassays that require the specific detection of canine CRP.</p>

<p>anti-Dog IgE Antibody</p>

<p>Please enquire for more information about Affinity Purified anti-V5 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Mouse anti-Human IgG (gamma chain specific) Monoclonal Antibody</p>

<p>Affinity Purified Donkey anti-Sheep IgG h+l Antibody</p>

<p>Monoclonal Mouse anti-FLAG-Tag (TM) Antibody recognizes N-terminal, C-terminal or internal DYKDDDDK-tagged fusion proteins. Validated for use in Western Blot and ELISA assays.</p>

<p>Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Rabbit polyclonal RAPGEFL1 antibody</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>Rabbit polyclonal SLC12A4 antibody</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>The CYP2J2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that specifically targets the CYP2J2 enzyme, which plays a crucial role in the metabolism of arachidonic acid. This antibody has high bioavailability and can effectively neutralize the activity of CYP2J2.</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>Human Haptoglobin Reference Serum</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Rabbit polyclonal USP28 antibody</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>Affinity Purified Goat anti-Chicken IgY Fc Antibody. Please inquire for bulk pricing or custom conjugations.</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>MAST1 antibody was raised in Rabbit using Human MAST1 as the immunogen</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Rabbit polyclonal ROBO3 antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>

<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>Rabbit polyclonal RSU1 antibody</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>The SURVIVIN antibody is a powerful tool in the field of Life Sciences. It is an essential biomolecule that plays a crucial role in cell survival and proliferation. This antibody specifically targets survivin, an anti-apoptotic protein that is highly expressed in various tumor cells.</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>

<p>LZTFL1 antibody was raised in Rabbit using Human LZTFL1 as the immunogen</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT</p>

<p>The RRM2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets the growth hormone receptor and has been shown to inhibit lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used in various applications such as immunohistochemistry and Western blotting. It is available both as polyclonal antibodies, which offer broad specificity, and monoclonal antibodies, which provide high specificity. The RRM2 antibody has also been studied as a potential therapeutic target for inhibiting tyrosine kinase activity and blocking endothelial growth factor signaling pathways. Additionally, it has been used in combination with other inhibitors, such as trastuzumab, to enhance their efficacy. With its versatility and potential applications, the RRM2 antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>Rabbit polyclonal SGK3 antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>Rabbit polyclonal PFDN4 antibody</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>MAOA antibody was raised in Rabbit using Human MAOA as the immunogen</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Rabbit polyclonal LRP2 antibody</p>

<p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

<p>The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>Rabbit polyclonal EIF2C1 antibody</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>Rabbit polyclonal PDCD1 antibody</p>

<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>