Primary Antibodies

<p>Goat polyclonal FABP antibody</p>

<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.</p>

<p>Aldosterone-3 antibody was raised in rabbit using aldosterone-3-BSA as the immunogen.</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>Goat anti Human IgM antibody</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>

<p>hCG antibody was raised in goat using highly pure immuno grade hCG as the immunogen.</p>

<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>Goat polyclonal FABP antibody</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>Mouse monoclonal HIV1 Nef C-terminal antibody (biotin)</p>

<p>Folic acid antibody was raised in rabbit using folic acid-BSA as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>hCG beta antibody was raised in goat using affinity purified hCG beta as the immunogen.</p>

<p>Mouse monoclonal REV (HIV-1 HxB2, HxB3) antibody (FITC)</p>

<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>

<p>Donkey polyclonal anti Human Lambda Light Chain antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>

<p>EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.</p>

<p>hCG antibody was raised in mouse using hCG affinity pure from pregnancy urine as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (FITC); concentration 1 mg/ml</p>

<p>Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.</p>

<p>Androstenedione antibody was raised in rabbit using androstenedione-19 as the immunogen.</p>

<p>HIV1 Nef antibody (FITC) was raised using purified recombinant nef (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (FITC)</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that exhibits cytotoxic properties against the Ebola virus. This antibody specifically targets and neutralizes the glycoprotein present on the surface of the virus, preventing it from infecting host cells.</p>

<p>Androstenedione antibody was raised in rabbit using 4-androstene 3, 17-dione-11-protein conjugate as the immunogen.</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>Mouse monoclonal HIV1-RT antibody (HRP)</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 1.0 mg/ml</p>

<p>Cortisol 3 antibody was raised in mouse using cortisol-3-BSA as the immunogen.</p>

<p>Goat polyclonal Human Ferritin antibody</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>

<p>The ST2 antibody is a powerful tool in the field of Life Sciences. It specifically targets the IL-1 receptor and its binding proteins, making it an essential component in various experiments and research studies. The ST2 antibody is produced by a hybridoma cell line and has been extensively characterized for its specificity and potency.<br><br>One of the key applications of the ST2 antibody is its use as a neutralizing agent for interleukin (IL) signaling pathways. By blocking the interaction between IL-1 receptor and its ligands, the ST2 antibody effectively inhibits downstream signaling events, providing valuable insights into cellular responses mediated by IL-1.<br><br>Moreover, the ST2 antibody has been shown to have a high affinity for histone H1, a protein involved in chromatin structure and gene regulation. This interaction suggests that the ST2 antibody may play a role in modulating chromatin dynamics and epigenetic processes.<br><br>In addition to its research applications, the ST2 antibody can also be used as a</p>

<p>Rabbit polyclonal HIV1-RT antibody</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV) produced in baculovirus as the immunogen.</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>

<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (HRP)</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>HIV1-RT antibody (FITC) was raised in mouse using purified, full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>Rabbit polyclonal cAMP antibody</p>

<p>Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Goat polyclonal anti Human lambda light chain antibody</p>

<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>

<p>PLAC1 antibody was raised in rabbit using placenta specific antigen 1 (PLAC1) as the immunogen.</p>

<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.</p>

<p>THC antibody was raised in rabbit using D8-THC-KLH as the immunogen.</p>

<p>Substance P antibody was raised in rabbit using substance P-BSA as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>