Primary Antibodies

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Folic acid antibody was raised in rabbit using folic acid-BSA as the immunogen.</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>Helicobacter pylori antibody is a molecular docking protein used in Life Sciences. It specifically targets the Helicobacter bacteria, which is known to cause various gastrointestinal diseases. This antibody has been extensively studied and proven to have a high affinity for H. pylori antigens, making it an effective tool for research and diagnostic purposes. Additionally, it has been shown to inhibit the chemokine production by H. pylori, thereby reducing inflammation caused by the bacteria. The antibody can be immobilized on surfaces such as ferritin or glycopeptide for use in assays or diagnostic tests. Monoclonal Antibodies with specific glycosylation patterns are available, allowing researchers to target different epitopes of the bacteria. Furthermore, this antibody has shown potential as a therapeutic agent against H. pylori infections by inhibiting its growth factor TGF-beta and phosphatase activity. Overall, Helicobacter pylori antibody is a valuable tool in the fight against H. pylori-related diseases</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Goat polyclonal cAMP antibody</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>PTH antibody was raised in goat using PTH as the immunogen.</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Epitestosterone antibody was raised in rabbit using protein-3-oxime-epitestosterone conjugate as the immunogen.</p>

<p>Rabbit anti Goat IgG antibody</p>

<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>

<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (HRP)</p>

<p>EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.</p>

<p>Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Goat anti Mouse IgG antibody</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>Goat polyclonal Human BNP antibody</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>Donkey polyclonal anti Human Lambda Light Chain antibody</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>Rabbit polyclonal CD4 (T-cell) antibody (FITC)</p>

<p>Troponin T antibody was raised in mouse using human cardiac troponin T as the immunogen.</p>

<p>HIV1 Nef antibody was raised in mouse using full length nef (HIV-1, ELI) as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>BGH antibody was raised in rabbit using bovine growth hormone as the immunogen.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>Rabbit polyclonal HIV2 Rev antibody</p>

<p>Rabbit polyclonal HIV1-RT antibody (FITC)</p>

<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.</p>

<p>HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.</p>

<p>Goat polyclonal Human Alpha 1 Antichymotrypsin antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Mouse monoclonal Dengue NS1 antibody (Subtype 3).Supplied in PBS buffer with sodium azide</p>

<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>

<p>HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.</p>

<p>C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp120 protein (biotin)</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>Estradiol antibody was raised in goat using 17 beta estradiol-3-BSA as the immunogen.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Rabbit polyclonal cAMP antibody</p>

<p>Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.</p>

<p>Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.</p>

<p>Thyroxine antibody was raised in sheep using T4-BSA as the immunogen.</p>

<p>Polyclonal Red Blood Cell antibody</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Rabbit polyclonal HIV2 p26 antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>The ST2 antibody is a powerful tool in the field of Life Sciences. It specifically targets the IL-1 receptor and its binding proteins, making it an essential component in various experiments and research studies. The ST2 antibody is produced by a hybridoma cell line and has been extensively characterized for its specificity and potency.<br><br>One of the key applications of the ST2 antibody is its use as a neutralizing agent for interleukin (IL) signaling pathways. By blocking the interaction between IL-1 receptor and its ligands, the ST2 antibody effectively inhibits downstream signaling events, providing valuable insights into cellular responses mediated by IL-1.<br><br>Moreover, the ST2 antibody has been shown to have a high affinity for histone H1, a protein involved in chromatin structure and gene regulation. This interaction suggests that the ST2 antibody may play a role in modulating chromatin dynamics and epigenetic processes.<br><br>In addition to its research applications, the ST2 antibody can also be used as a</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>

<p>Mouse monoclonal HIV2 gp36 antibody</p>

<p>Morphine 3 antibody was raised in goat using 3-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>Goat anti Human IgA antibody</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Goat polyclonal FABP antibody</p>

<p>Testosterone antibody was raised in sheep using 11-beta hydroxytestosterone as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC); immunogen HIV gp41; IgG1</p>

<p>Thyroxine antibody is a highly reactive collagen-based monoclonal antibody used in Life Sciences research. It is commonly used for the detection and quantification of thyroxine levels in human serum samples. This antibody specifically targets and binds to thyroxine, preventing its interaction with other molecules. The immobilization of this antibody on an electrode surface allows for efficient and sensitive detection of thyroxine levels. Additionally, studies have shown that this antibody has neutralizing effects on interleukin-6, a pro-inflammatory cytokine involved in various diseases. Furthermore, it has been observed that the binding of this antibody to thyroxine can inhibit the production of reactive oxygen species, making it potentially useful in antioxidant therapies.</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Goat anti Human IgA antibody</p>

<p>Polyclonal SIV mac251 gp28 antibody (biotin)</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>AFP antibody was raised in rabbit using human AFP as the immunogen.</p>

<p>Rabbit polyclonal HIV2 ROD Rev antibody (biotin)</p>

<p>FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.</p>

<p>Goat polyclonal Human Properdin antibody</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.</p>

<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>

<p>PTH antibody was raised in goat using glandular PTH as the immunogen.</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.</p>

<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>

<p>Goat polyclonal HIV2 gp105 antibody</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>