Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,606 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,735 products)
- Metabolism Antibodies(277 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV2 p26 antibody (HRP)
<p>Mouse monoclonal HIV2 p26 antibody (HRP)</p>Purity:> 95% Purity As Estimated By Analysis Of Sds-Page Gel Prior To Labeling.Ebola Virus antibody
<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>Purity:Min. 95%Measles Virus Nucleoprotein antibody
<p>Measles virus nucleoprotein antibody was raised in goat using full length recombinant measles virus nucleoprotein produced in baculovirus expression system as the immunogen.</p>Estriol 6 antibody
<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>Theophylline antibody
<p>Theophylline antibody was raised in mouse using theophylline as the immunogen.</p>HIV1 rev antibody (FITC)
<p>HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.</p>Measles Virus Nucleoprotein antibody
<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>hCG beta antibody
<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>Purity:Min. 95%Progesterone 3 antibody
<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>Purity:With Sensitivity ToGoat anti Human Lambda light chain
<p>Goat polyclonal anti Human Lambda light chain antibody</p>Purity:Min. 95%Ebola Virus antibody
<p>The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.</p>Streptococcus Group A antibody
<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>Purity:Min. 95%TSH antibody
<p>TSH antibody was raised in rabbit using human pituitary TSH affinity purified antigen as the immunogen.</p>Purity:Min. 95%CD4 antibody
<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>HIV1 rev antibody
<p>HIV1 rev antibody was raised in mouse using full length recombinant rev (HIV-1) produced in E.coli expression system as the immunogen.</p>cAMP antibody
<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>Purity:Min. 95%Cocaine antibody
<p>Cocaine antibody was raised in goat using cocaine-KLH as the immunogen.</p>Purity:Min. 95%Borrelia burgdorferi antibody
<p>Borrelia burgdorferi antibody was raised in sheep using lyme disease (Borrelia Burdorferi) as the immunogen.</p>Purity:Min. 95%FSH β antibody
<p>FSH Beta antibody was raised in rabbit using FSH beta-KLH as the immunogen.</p>Purity:Min. 95%FABP antibody
<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>ApoA-II antibody
<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>Purity:Min. 95%Myoglobin antibody
<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>CD4 antibody
<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>Chymotrypsin antibody
<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>Purity:Min. 95%HIV1 p24 antibody
<p>HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.</p>Purity:Min. 95%HIV1-RT antibody
<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>Estradiol 6,17 beta antibody
<p>Estradiol 6,17 b antibody was raised in rabbit using Estradiol-17 beta-6-CMO-BSA as the immunogen.</p>Purity:Min. 95%Triiodothyronine antibody
<p>Triiodothyronine antibody was raised in goat using triiodothyronine-BSA as the immunogen.</p>Purity:Min. 95%Gastrin antibody
<p>Gastrin antibody was raised in rabbit using human gastrin as the immunogen.</p>Purity:Min. 95%Donkey anti Goat IgG
<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>Purity:Min. 95%Rabbit anti Sheep IgG
<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>Purity:Min. 95%Measles Virus Nucleoprotein antibody (FITC)
<p>Goat polyclonal Measles Virus Nucleoprotein antibody (FITC)</p>CD4 (T cell receptor) antibody (biotin)
<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>Luteinizing Hormone antibody
<p>Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.</p>Goat anti Guinea Pig IgG
<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>Purity:Min. 95%hCG antibody
<p>hCG antibody was raised in mouse using hCG affinity pure from pregnancy urine as the immunogen.</p>HIV1 p24 antibody (IgG purified)
<p>HIV1 p24 antibody (IgG purified) was raised in sheep using purified full length recombinant p24 as the immunogen.</p>o-Dianisidine Dihydrochloride [for Biochemical Research]
CAS:Formula:C14H16N2O2·2HClPurity:>98.0%(HPLC)Color and Shape:White to Gray to Red powder to crystalMolecular weight:317.21Fluorescein Isothiocyanate (mixture of 5- and 6- isomers)
CAS:Formula:C21H11NO5SPurity:>97.0%(T)(HPLC)Color and Shape:Light yellow to Brown powder to crystalMolecular weight:389.38Zika Virus Envelope Antigen Mouse Monoclonal Antibody
<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.</p> <p>The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>Goat anti Rabbit IgG (H + L) (biotin)
<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>Purity:Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>VIM antibody
<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>Purity:Min. 95%HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Purity:Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Purity:Min. 95%SMAD6 antibody
<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Purity:Min. 95%BACE1 antibody
<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Purity:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Purity:Min. 95%SYT11 antibody
<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>Purity:Min. 95%Endothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Purity:Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Purity:>92% By Gel Electrophoresis And Gel ScanningSDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Purity:Min. 95%TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Purity:Min. 95%CD152 antibody (PE)
<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>Purity:Min. 95%Rabbit anti Goat IgG (H + L) (Alk Phos)
<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Purity:Min. 95%LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>CD30 antibody (FITC)
<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Purity:Min. 95%SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Purity:Min. 95%Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>Caspase 1 antibody
<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>Neurochondrin antibody
<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>...C-peptide antibody
<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>FGF18 antibody
<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>H+K+ ATPase antibody
<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>Rab23 antibody
<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>Purity:Min. 95%Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Purity:Min. 95%EVX1 antibody
<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>Purity:Min. 95%Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Purity:Min. 95%Rabbit anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%HSPG2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>CYP2A6 antibody
<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Purity:Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Tau antibody
<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>Mouse anti-Brucella abortus antibody
<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>anti-Human Procalcitonin (PCT) Antibody
<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>Purity:Min. 95%Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>GPR37L1 antibody
<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Purity:Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Purity:Min. 95%MYBPH antibody
<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>Purity:Min. 95%


