Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,691 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 69953 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>Purity:Min. 95%CD4 (T cell receptor) antibody (FITC)
<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>ApoA-I antibody
<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>Thyroxine antibody
<p>Thyroxine antibody was raised in rabbit using thyroxine-BSA as the immunogen.</p>Purity:Min. 95%HIV1 tat antibody
<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>Purity:Min. 95%hCG beta antibody
<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>Purity:Min. 95%cAMP antibody
<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>Purity:Min. 95%Serotonin antibody
<p>Serotonin antibody was raised in sheep using serotonin-Tg as the immunogen.</p>Purity:Min. 95%TSH antibody
<p>TSH antibody was raised in rabbit using human pituitary TSH affinity purified antigen as the immunogen.</p>Purity:Min. 95%CD4 antibody
<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>Purity:Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>Pf HRP2 antibody
<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>CRP antibody
<p>CRP antibody was raised in Goat using C-Reactive Protein purified from normal human Plasma/Serum as the immunogen.</p>NFkB regulatory factor antibody
<p>Rabbit polyclonal NFkB regulatory factor antibody</p>Purity:Min. 95%Goat anti Human Kappa + Lambda light chain
<p>Goat anti Human kappa + lambda light chain secondary antibody</p>Anti-FGFR2b antibody - 1mg/mL
<p>The fibroblast growth factor receptor (FGFR) family consists of four transmembrane receptor tyrosine kinases (FGFR1-4), which regulate important physiological processes, such as cell proliferation, differentiation, migration and survival throughout the body. FGFR2b is known as the epithelial FGFR2 isoform. FGFR2b/KGFR is exclusively expressed in epithelial cells and can be activated by stimulation with its specific ligands FGF7/KGF or FGF10. Ligand binding results in a signalling cascade which includes phosphoinositide 3-kinase (PI3K) and mitogen-activated protein kinase (MAPK) signalling pathways and/or activation of phospholipase C-γ (Plc-γ). FGFR2b activation culminates in the survival, growth, and differentiation of epithelial cells, triggers phagocytosis and melanosome uptake in human keratinocytes and is critical for proper craniofacial development.<br>1mg/ml. For use in WB (1:100) and ELISA (1:1000). Reacts with human.<br>Image: Western blot analysis of conditioned media from non-transfected HEK293 cells.</p>Color and Shape:Clear LiquidMolecular weight:85,000 g/molChymotrypsin antibody
<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>Purity:Min. 95%Myoglobin antibody
<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>Histone 2B antibody
<p>Histone 2B antibody was raised in sheep using Intact calf histone H2B-rRNA complex as the immunogen.</p>Purity:Min. 95%Luteinizing Hormone antibody
<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>Purity:Min. 95%Dengue NS1 antibody (Subtype 3)
<p>Mouse monoclonal Dengue NS1 antibody (Subtype 3).Supplied in PBS buffer with sodium azide</p>Estradiol 6,17 beta antibody
<p>Estradiol 6,17 b antibody was raised in rabbit using Estradiol-17 beta-6-CMO-BSA as the immunogen.</p>Purity:Min. 95%Anti-SLC12A2 antibody R2G - 1mg/mL
<p>The SLC12 family consists of nine member proteins, SLCA1 through to SLC12A9. Solute Carrier Family 12 Member 2 (SLC12A2) encodes a protein used in mediating the cotransport and reabsorption of Na+, K+ and 2Cl- ions (NKCC), it is a membrane-bound symporter channel needed for both epithelial absorption and secretion of ions. SLC12A2 spans the membrane and is necessary in maintaining ionic balance, cell volume and overall homeostasis of a cell.SLC12A2 is shown to be involved in neurodevelopment, specifically in the cortex, and is associated with neurodevelopmental disorders, with SLC12A2 mutation rate being significantly higher in individuals with neurodevelopmental issues. Additionally, mutations in SLC12A2 have been shown to cause issues with sensorineural pathways, causing hearing loss and deafness. Research into SLC12A2 and the SLC12 family as a whole could be beneficial in finding treatments for these complex neuronal issues.</p>CMV p28 UL99 antibody
<p>CMV p28 UL99 antibody was raised in mouse using cytomegalovirus minor capsid protein p28 as the immunogen.</p>HIV2 gp105 antibody
<p>HIV2 gp105 antibody was raised in rabbit using purified, full length recombinant gp105 (HIV-2 ROD) as the immunogen.</p>Purity:Min. 95%Bradykinin antibody
<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>Purity:Min. 95%PTH antibody
<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>Purity:Min. 95%HIV1 tat antibody
<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>HIV-1 gp120 Sheep Polyclonal Antibody, Affinity Purified
<p>This polyclonal antibody product: affinity purified Sheep Anti-HIV-1-gp120 was produced by first immunizing sheep with a single synthetic peptide which has the amino acid sequence: APTKAKRRVVQREKR. This amino acid sequence corresponds to amino acid section 497-511 in the envelope gene gp120 protein of the BH-10 strain of HIV-1. The antibodies are then isolated from the sheep hyperimmune serum by affinity chromatography using the APTKAKRRVVQREKR sequenced synthetic peptide coupled to Sepharose. The serological activity of the antibodies is checked by ELISA and lyophilized in PBS. 0.15M NaCl (pH 7.4) without preservative.<br>The glycoprotein gp120 is an essential Human Immunodeficiency virus (HIV) envelope subunit which facilitates the entry of the HIV into CD4 T cells through binding to CD4 receptors and CCR5 or CXCR4 chemokine co-receptors on host cells. This attachment enables the second key envelope glycoprotein gp41 to form a six-helix bundle and therefore fuse to the host cell membrane. This HIV gp120 complementary antibody can be used to detect the presence of the HIV gp120 subunit in antigen detection assays such as ELISA, automated immunoassays, western blot and lateral flow.</p>HPV6 antibody
<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>HIV1-RT antibody
<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>Helicobacter pylori antibody
<p>Helicobacter pylori antibody is a molecular docking protein used in Life Sciences. It specifically targets the Helicobacter bacteria, which is known to cause various gastrointestinal diseases. This antibody has been extensively studied and proven to have a high affinity for H. pylori antigens, making it an effective tool for research and diagnostic purposes. Additionally, it has been shown to inhibit the chemokine production by H. pylori, thereby reducing inflammation caused by the bacteria. The antibody can be immobilized on surfaces such as ferritin or glycopeptide for use in assays or diagnostic tests. Monoclonal Antibodies with specific glycosylation patterns are available, allowing researchers to target different epitopes of the bacteria. Furthermore, this antibody has shown potential as a therapeutic agent against H. pylori infections by inhibiting its growth factor TGF-beta and phosphatase activity. Overall, Helicobacter pylori antibody is a valuable tool in the fight against H. pylori-related diseases</p>HIV1 p17 antibody (HRP)
<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>CD4 (T cell receptor) antibody (FITC)
<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45</p>COX2 antibody
<p>COX2 antibody was raised in mouse using recombinant human COX 2 protein as the immunogen.</p>Purity:Min. 95%CD4 (T cell receptor) antibody (biotin)
<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>o-Dianisidine Dihydrochloride [for Biochemical Research]
CAS:Formula:C14H16N2O2·2HClPurity:>98.0%(HPLC)Color and Shape:White to Gray to Red powder to crystalMolecular weight:317.21Fluorescein Isothiocyanate (mixture of 5- and 6- isomers)
CAS:Formula:C21H11NO5SPurity:>97.0%(T)(HPLC)Color and Shape:Light yellow to Brown powder to crystalMolecular weight:389.38Zika Virus Envelope Antigen Mouse Monoclonal Antibody
<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.</p> <p>Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.</p> <p>The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Purity:Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Purity:Min. 95%anti-Human Procalcitonin (PCT) Antibody
<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>Purity:Min. 95%VIM antibody
<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>Purity:Min. 95%CD80 antibody
<p>The CD80 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD80, a protein involved in immune responses and cell signaling. This antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting.</p>PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>ELOF1 antibody
<p>ELOF1 antibody was raised in rabbit using the middle region of ELOF1 as the immunogen</p>anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Purity:Min. 95%CD152 antibody (PE)
<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>Purity:Min. 95%Neurochondrin antibody
<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Purity:Min. 95%Rab23 antibody
<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>Purity:Min. 95%Tau antibody
<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>MTUS1 antibody
<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>PEX5 antibody
<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Purity:Min. 95%CYP2A6 antibody
<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>HSPG2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>PCBP2 antibody
<p>The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.</p>Goat anti Mouse IgM (mu chain)
<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>Purity:Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Purity:Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Purity:Min. 95%TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Purity:Min. 95%CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Purity:Min. 95%FGF18 antibody
<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>DGKA antibody
<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>Mouse anti-Brucella abortus antibody
<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rabbit anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Purity:Min. 95%CD30 antibody (FITC)
<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Purity:Min. 95%H+K+ ATPase antibody
<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>Myeloperoxidase antibody
<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>SMAD6 antibody
<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>Rabbit anti Goat IgG (H + L) (Alk Phos)
<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Purity:Min. 95%MYBPH antibody
<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>Purity:Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Purity:>92% By Gel Electrophoresis And Gel ScanningHSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>EVX1 antibody
<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>Purity:Min. 95%MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Purity:Min. 95%GPR37L1 antibody
<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%Endothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>C20orf132 antibody
<p>C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH</p>...C-peptide antibody
<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Purity:Min. 95%MZF1 antibody
<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>Caspase 1 antibody
<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>Goat anti Rabbit IgG (H + L) (biotin)
<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>Purity:Min. 95%Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Purity:Min. 95%BACE1 antibody
<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%SYT11 antibody
<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>Purity:Min. 95%FAF1 antibody
<p>FAF1 antibody was raised in rabbit using the C terminal of FAF1 as the immunogen</p>FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Purity:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Purity:Min. 95%


