Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD61 antibody
The CD61 antibody is a monoclonal antibody that specifically targets the CD61 protein. This protein plays a crucial role in various cellular processes, including cell adhesion and platelet aggregation. The CD61 antibody has been extensively studied in the field of life sciences, particularly in research related to epidermal growth factor and insulin antibodies.LRG1 antibody
LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPNUDCD3 antibody
NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDSeptin 2 antibody
Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Purity:Min. 95%SIRT4 antibody
SIRT4 antibody was raised in rabbit using the N terminal of SIRT4 as the immunogenPurity:Min. 95%ACTL6A antibody
ACTL6A antibody was raised using the N terminal of ACTL6A corresponding to a region with amino acids VDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAMRPL15 antibody
MRPL15 antibody was raised using the N terminal of MRPL15 corresponding to a region with amino acids KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNZNF529 antibody
ZNF529 antibody was raised in rabbit using the middle region of ZNF529 as the immunogenPurity:Min. 95%MYB antibody
MYB antibody was raised in rabbit using the N terminal of MYB as the immunogenPurity:Min. 95%FABP7 antibody
FABP7 antibody was raised using the N terminal of FABP7 corresponding to a region with amino acids NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFMyeloperoxidase antibody
The Myeloperoxidase antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to myeloperoxidase, an enzyme found in abundance in neutrophils and monocytes. By binding to myeloperoxidase, this antibody can be used for a variety of applications including immunohistochemistry, flow cytometry, and Western blotting.SOX4 antibody
SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogenPurity:Min. 95%CAS antibody
CAS antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and has been proven to be effective in detecting microvessel density. This antibody specifically targets tumor necrosis factor-alpha (TNF-α) and can be used for various applications, such as immunohistochemistry and Western blotting. CAS antibody also has the ability to bind to mimetic peptides and nuclear proteins, making it a versatile tool for research purposes. Additionally, this antibody can be used as a cross-linking agent in polymerase chain reactions (PCR) and has been shown to activate vascular endothelial growth factor-C (VEGF-C), which plays a crucial role in angiogenesis. With its high specificity and reliability, CAS antibody is an essential component for any laboratory studying cellular processes and protein interactions.Guf1 antibody
Guf1 antibody was raised in rabbit using the C terminal of Guf1 as the immunogen
Purity:Min. 95%SLC11A2 antibody
SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF
Purity:Min. 95%Mkx antibody
Mkx antibody was raised in rabbit using the C terminal of Mkx as the immunogenPurity:Min. 95%beta Amyloid antibody
The beta Amyloid antibody is a highly effective and versatile product that offers a range of benefits in the field of Life Sciences. It is a Polyclonal Antibody that has been specifically designed to target and neutralize the beta-amyloid protein, which is associated with neurodegenerative diseases such as Alzheimer's.Purity:Min. 95%MAS1 antibody
MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIPurity:Min. 95%MBNL2 antibody
MBNL2 antibody was raised in rabbit using the middle region of MBNL2 as the immunogenPurity:Min. 95%CDH16 antibody
The CDH16 antibody is a polyclonal antibody that is highly effective in targeting specific proteins involved in various cellular processes. This antibody has cytotoxic properties and has been shown to inhibit the growth of cancer cells by targeting c-myc, insulin, erythropoietin, and anti-VEGF. It can be used in a variety of assays and research applications in the field of Life Sciences. The CDH16 antibody specifically targets growth factors and endothelial growth, making it an essential tool for studying cellular pathways and identifying potential therapeutic targets.IL1RL2 antibody
IL1RL2 antibody was raised in rabbit using the N terminal of IL1RL2 as the immunogenPurity:Min. 95%Annexin A6 antibody
Annexin A6 antibody was raised using the N terminal of ANXA6 corresponding to a region with amino acids ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYEBcat1 antibody
Bcat1 antibody was raised in rabbit using the C terminal of Bcat1 as the immunogenPurity:Min. 95%NONO antibody
The NONO antibody is a highly specialized antibody used in Life Sciences research. It specifically targets the protein NONO, which plays a crucial role in various cellular processes. This polyclonal antibody is designed to recognize and bind to NONO with high specificity and affinity.SCG3 antibody
SCG3 antibody was raised in rabbit using the C terminal of SCG3 as the immunogenPurity:Min. 95%uPA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug known for its bactericidal activity against tuberculosis infection. As one of the active compounds in rifamycins, it inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Rifapentine specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
