Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
Claudin 1 antibody
The Claudin 1 antibody is a therapeutically valuable monoclonal antibody that acts as an inhibitor of kinases. It is widely used in the field of Life Sciences for its antiviral properties. This antibody targets and inhibits specific kinases, which are enzymes that play a crucial role in various cellular processes. By inhibiting these kinases, the Claudin 1 antibody can effectively block viral replication and prevent the spread of infections.TRIM2 antibody
The TRIM2 antibody is a monoclonal antibody that specifically targets epidermal growth factor (EGF). It is highly effective in detecting and quantifying EGF levels in various biological samples. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for research in the field of life sciences.
LEC antibody
LEC antibody was raised in mouse using highly pure recombinant human LEC as the immunogen.
CRTC1 antibody
CRTC1 antibody was raised in Mouse using a purified recombinant fragment of human CRTC1 expressed in E. coli as the immunogen.IL6 antibody
The IL6 antibody is a powerful cytotoxic agent that targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various diseases. This monoclonal antibody specifically binds to IL-6, neutralizing its activity and preventing its interaction with cell surface receptors. By blocking the IL-6 signaling pathway, this antibody inhibits the production of other inflammatory mediators such as tumor necrosis factor-alpha (TNF-α) and interferons.LRRC49 antibody
LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRSABL1 antibody
The ABL1 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It is designed to target and bind to the ABL1 protein, which plays a crucial role in cell signaling and regulation. This antibody has been extensively tested and characterized for its high affinity and specificity, ensuring accurate and reliable results in various immunoassays.FAK antibody
The FAK antibody is a highly effective monoclonal antibody used in Life Sciences. It belongs to the family of antibodies targeting specific growth factors, such as trastuzumab and adalimumab. This antibody specifically targets CD33, a protein expressed on the surface of certain cells. By neutralizing CD33, the FAK antibody inhibits the growth and proliferation of these cells.
MKK4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.
SAP130 antibody
The SAP130 antibody is a highly specialized antibody used in Life Sciences research. It is known for its cytotoxic properties and its ability to target specific antigens. This antibody has been extensively tested and proven to have a strong antigen-antibody reaction, making it an ideal tool for various applications in the field.Goat anti Mouse IgG (H + L)
Goat anti-mouse IgG (H+L) was raised in goat using murine IgG, whole molecule as the immunogen.Purity:Min. 95%Rabbit anti Chicken IgG (H + L) (Alk Phos)
Rabbit anti-chicken IgG (H+L) (Alk Phos) was raised in rabbit using chicken IgG whole molecule as the immunogen.Purity:Min. 95%Goat anti Human IgA (alpha chain) (Alk Phos)
Goat anti-Human IgA (alpha chain) (Alk Phos) was raised in goat using purified Human IgA as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (Fab'2) (HRP)
Goat anti-rabbit IgG (Fab'2) (HRP) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Plakophilin 3 antibody
Plakophilin 3 antibody was raised in Guinea Pig using human recombinant plakophilin 3 peptide purified from E. coli as the immunogen.Purity:Min. 95%alpha Melanocyte Stimulating Hormone antibody
alpha Melanocyte Stimulating Hormone antibody was raised in rabbit using synthetic alpha-MSH conjugated to BSA as the immunogen.Purity:Min. 95%Goat anti Chicken IgG (H + L) (HRP)
This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.Purity:Min. 95%BACE1 antibody
BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%TRIM32 antibody
TRIM32 antibody was raised in rabbit using the C terminal of TRIM32 as the immunogenPurity:Min. 95%ATF2 antibody
The ATF2 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically binds to ATF2, a transcription factor that plays a crucial role in various cellular processes. This monoclonal antibody is widely used in research and diagnostic applications to study the function and regulation of ATF2.Purity:Min. 95%p53 antibody
The p53 antibody is a synthetic antibody that specifically targets the p53 protein. It is commonly used in life sciences research to study the role of p53 in various cellular processes. The antibody binds to the p53 protein and can be used for immunohistochemistry, western blotting, and other techniques to detect and analyze p53 expression levels. It is a valuable tool for researchers studying cancer, as mutations in the p53 gene are frequently associated with tumor development. In addition, this antibody has been shown to have inhibitory effects on butyrylcholinesterase activity and can also modulate the function of TRPV4 channels. With its high specificity and versatility, the p53 antibody is an essential component of any laboratory focused on molecular biology and cell signaling research.Purity:Min. 95%Goat anti Rat IgG (Fab'2) (Texas Red)
Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%BD2 antibody
BD2 antibody was raised in goat using highly pure recombinant human BD-2 as the immunogen.Purity:Min. 95%DNA PKcs antibody
The DNA PKcs antibody is a highly versatile and multidrug antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the DNA-dependent protein kinase catalytic subunit (DNA PKcs). This antibody has been extensively studied for its ability to interact with actin filaments and heterologous polypeptides, making it an invaluable tool for researchers studying cellular processes such as cell migration and cytoskeletal dynamics.
Purity:Min. 95%
