Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C-Fos antibody
The C-Fos antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein c-Fos, which is involved in various cellular processes such as cell growth and differentiation. This antibody recognizes the amino group of c-Fos and can be used for applications such as immunohistochemistry, western blotting, and ELISA.Purity:Min. 95%TMEM5 antibody
TMEM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rabbit anti Goat IgG Fc (Alk Phos)
This antibody reacts with heavy chains on Goat IgG.Purity:Min. 95%Rabbit anti Sheep IgG (H + L) (HRP)
Rabbit anti-sheep IgG (H+L) (HRP) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%VWF antibody
VWF antibody was raised in sheep using purified rat vWF from rat plasma as the immunogen.Purity:Min. 95%α Synuclein antibody
The alpha Synuclein antibody is a cytotoxic antibody commonly used in Life Sciences research. It specifically targets the phosphatase activity of alpha Synuclein dimers, which are known to be involved in various cellular processes. This antibody has been extensively studied and has shown high specificity and sensitivity in detecting alpha Synuclein autoantibodies in human serum samples. Additionally, it has been demonstrated to effectively neutralize the colony-stimulating factor activity of alpha Synuclein, suggesting its potential therapeutic applications in regulating immune responses. With its exceptional performance and versatility, the alpha Synuclein antibody is an essential tool for researchers studying the role of alpha Synuclein in different biological contexts.Purity:Min. 95%CCR5 antibody
CCR5 antibody is a type of inhibitor that targets the chemokine receptor CCR5. It has been shown to neutralize the activity of CCR5 and inhibit its interaction with human serum and actin filaments. This antibody is commonly used in Life Sciences research to study the role of CCR5 in various cellular processes. Additionally, it has been found to have potential therapeutic applications in autoimmune diseases and cancer treatment. The CCR5 antibody can also be used in conjunction with other antibodies or drugs, such as taxol, to enhance their effectiveness. Its ability to modulate interferon gamma (IFN-gamma) signaling and growth factor pathways makes it a valuable tool for studying immune responses and cell growth regulation.Purity:Min. 95%RAB9A antibody
RAB9A antibody was raised in rabbit using the middle region of RAB9A as the immunogenPurity:Min. 95%Histamine antibody
Histamine antibody was raised in rabbit using histamine-BSA as the immunogen.Purity:Min. 95%PDE8B antibody
PDE8B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Keratin K10 antibody
Keratin K10 antibody was raised in Guinea Pig using synthetic peptide of human keratin K10 coupled to KLH as the immunogen.Purity:Min. 95%PDE6A antibody
PDE6A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rabbit anti Dog IgG
Rabbit anti-dog IgG was raised in rabbit using canine IgG F(c) fragment as the immunogen.Purity:Min. 95%Keratin K13 antibody
Keratin K13 antibody was raised in Guinea Pig using synthetic peptide of human keratin K13 coupled to KLH as the immunogen.Purity:Min. 95%Rb antibody
The Rb antibody is a monoclonal antibody that is used in the field of Life Sciences. It contains excipients and globulin, which contribute to its stability and effectiveness. This antibody specifically targets MERTK, a protein that plays a crucial role in cell signaling and regulation. By binding to MERTK, the Rb antibody inhibits its activity, leading to various biological effects. Additionally, this antibody has been shown to have low density and colloidal properties, allowing for easy dispersion and efficient delivery. The Rb antibody can be used in research settings to study cell signaling pathways, protein interactions, and kinase inhibition. Its versatility makes it an essential tool for scientists working in the field of Life Sciences.Purity:Min. 95%SGPP1 antibody
SGPP1 antibody was raised in rabbit using the middle region of SGPP1 as the immunogenPurity:Min. 95%BCAP31 antibody
BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Purity:Min. 95%Rabbit anti Chicken IgG (H + L) (HRP)
Rabbit anti-chicken IgG (H+L) (HRP) was raised in rabbit using chicken IgG whole molecule as the immunogen.Purity:Min. 95%Keratin K75 antibody
Keratin K75 antibody was raised in Guinea Pig using synthetic peptide of human type II keratin K75 coupled to KLH as the immunogen.Sheep anti Rabbit IgG (H + L) (biotin)
Sheep anti-rabbit IgG (H+L) (biotin) was raised in sheep using rabbit IgG whole molecule as the immunogen.Purity:Min. 95%Desmin antibody (Prediluted for IHC)
Rabbit polyclonal Desmin antibody (Prediluted for IHC)Purity:Min. 95%ELMO1 antibody
ELMO1 antibody was raised in rabbit using the C terminal of ELMO1 as the immunogen
Purity:Min. 95%Goat anti Rabbit IgG (rhodamine)
Goat anti-rabbit IgG (Rhodamine) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Purity:Min. 95%Donkey anti Sheep IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.Purity:Min. 95%Cu/Zn SOD antibody
Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.
Purity:Min. 95%FAK antibody
The FAK antibody is a protein that belongs to the Life Sciences category and falls under the Polyclonal Antibodies group. It is specifically designed to target nuclear proteins, including sclerostin and proteinase. This antibody works by binding to specific polypeptide sequences, allowing for accurate detection and analysis in various assays.
Purity:Min. 95%Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.DNER antibody
DNER antibody was raised in rabbit using the middle region of DNER as the immunogenPurity:Min. 95%PYGL antibody
PYGL antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%THRA antibody
THRA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Goat anti Bovine IgG (rhodamine)
Goat anti-bovine IgG (Rhodamine) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%GPR1 antibody
GPR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rat anti Mouse IgG1
Rat anti Mouse IgG1 is a globulin-based antibody that is commonly used in Life Sciences research. It is specifically designed to neutralize and bind to Mouse IgG1 antibodies, making it an essential tool for various laboratory applications. This antibody-drug has been extensively tested and validated for its high specificity and potency. It can be used as a secondary antibody in immunoassays such as ELISA, Western blotting, and immunohistochemistry. Rat anti Mouse IgG1 has been proven to effectively detect and quantify target proteins, hormones, enzymes, chemokines, and other biomolecules of interest. With its exceptional performance and reliable results, this antibody is a valuable asset for researchers in the field of Life Sciences.
Purity:Min. 95%PDE7B antibody
PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Calcitonin antibody
Calcitonin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Luciferase antibody
The Luciferase antibody is a highly specialized neutralizing antibody complex used in Life Sciences research. It plays a crucial role in the study of lipid peroxidation, cholinergic signaling, and luciferase catalyzed reactions. This Polyclonal Antibody is designed to target specific luciferases and inhibit their activity, allowing researchers to accurately measure and analyze various biological processes. The Luciferase antibody has been extensively tested and validated for use in liver microsomes, rat liver microsomes, and other relevant samples. Its high specificity ensures minimal interference with other cellular components, providing accurate results for experiments involving interleukin-6, interferon, and other important biomolecules. With its ability to neutralize luciferase activity and facilitate lysis of target cells, this monoclonal antibody is an invaluable tool for scientists working in the field of molecular biology and biochemistry.Purity:Min. 95%SOX2 antibody
The SOX2 antibody is a powerful tool used in Life Sciences research. It is specifically designed to target and bind to the SOX2 protein, which plays a crucial role in cellular development and differentiation. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.Purity:Min. 95%Rabbit anti Guinea Pig IgG (H + L) (FITC)
Rabbit anti-guinea pig IgG (H+L) (FITC) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.Purity:Min. 95%MAFF antibody
MAFF antibody was raised in rabbit using the N terminal of MAFF as the immunogenPurity:Min. 95%Capping Protein beta 3 antibody
Capping Protein beta 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine F-actin Beta 3 subunit capping protein coupled to KLH as the immunogen.Purity:Min. 95%Fatty Acid Synthase antibody
The Fatty Acid Synthase antibody is a polyclonal antibody that specifically targets the biomolecule involved in fatty acid synthesis. This antibody has been shown to be activated by interferon and can effectively neutralize the target molecule, making it a valuable tool in life sciences research. It has been used in various applications such as electrode coating, collagen staining, and immunohistochemistry. Additionally, this antibody has shown binding affinity to galectin-3, another important biomolecule. With its high specificity and versatility, the Fatty Acid Synthase antibody is an essential component for any researcher studying lipid metabolism or investigating related diseases.Purity:Min. 95%Chicken anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Histidine Decarboxylase antibody
Histidine decarboxylase antibody was raised in rabbit using recombinant histidine decarboxylase produced in E. Coli as the immunogen.Purity:Min. 95%Keratin K18 antibody
Keratin K18 antibody was raised in Guinea Pig using synthetic peptide from human keratin K18 as the immunogen.Purity:Min. 95%Rabbit anti Goat IgG (H + L) (Texas Red)
Rabbit anti-goat IgG (H+L) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%
