Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Elastase antibody
Elastase antibody was raised in mouse using purified human neutrophil elastase as the immunogen.
Befovacimab
CAS:Human monoclonal antibody targeting tissue factor pathway inhibitor (TFPI); non-replacement therapy for haemophilia A/B patients
HRP2 antibody
The HRP2 antibody is an immobilized monoclonal antibody used in Life Sciences. It is specifically designed to target interferon-gamma (IFN-gamma), a cytokine involved in immune response regulation. This antibody can be used for various applications, including the detection and quantification of IFN-gamma in biological samples. Additionally, the HRP2 antibody has been shown to bind to virus surface antigens, insulin-like growth factors, fatty acids, and hormone peptides. Its high specificity and affinity make it a valuable tool in research and diagnostics. Furthermore, this antibody has also been demonstrated to be effective against alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. With its versatility and wide range of applications, the HRP2 antibody is an essential component for any laboratory working in the field of immunology and molecular biology.
Adenovirus antibody
Adenovirus antibody was raised in mouse using ADV as the immunogen.Purity:>90% By Sds-PageIL6 monoclonal antibody
The IL6 monoclonal antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to interleukin-6 (IL6), a protein involved in various biological processes such as inflammation and immune response. By blocking the interaction between IL6 and its receptors, this monoclonal antibody can modulate the activity of IL6, leading to potential therapeutic benefits.C1 Esterase Inhibitor antibody
C1 Esterase Inhibitor antibody was raised in goat using C1 esterase inhibitor purified from human plasma as the immunogen.
Anti-MGAT1 antibody - 2mg/mL
Acyl-CoA:monoacylglycerol acyltransferase 1 (MGAT1) acylates monoacylglycerol to form diacylglycerol. MGAT activity is part of the MGAT pathway which allows the storage of neutral triacylglycerol (TAG). This is an auxiliary pathway to the glycerol-3-phosphate (G-3-P) pathway. MGAT1 is highly expressed in adipocytes and the liver; it may function to suppress aberrant lipolysis, which can lead to steatosis. MGAT isoforms (MGAT1, MGAT2, MGAT3) are increased in humans and mouse models of non-alcoholic fatty liver disease (NAFLD). Antisense oligonucleotides (ASO) have been used to reduce hepatic MGAT activity, which was independent of MGAT1. This improves hepatic insulin sensitivity and glucose metabolism without affecting hepatic DAG or TAG levels in obese mice models. The TAG synthesis in steatosis associated with lipodystrophy and obesity minimally depends on MOGAT1. The study of MGAT1 aims to improve understanding of insulin resistance and steatosis and better elucidate the function of MGAT1 in comparison to MGAT2 and MGAT3.
CKBB antibody
CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.Purity:Min. 95%Oxyphenbutazone antibody
Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.
Purity:Min. 95%Leptin antibody
Leptin antibody was raised in goat using highly pure recombinant rat leptin as the immunogen.
Purity:Min. 95%IGFBP3 antibody
The IGFBP3 antibody is a highly specific monoclonal antibody that targets the insulin-like growth factor binding protein 3 (IGFBP3). This growth factor plays a crucial role in regulating cell growth and development. The IGFBP3 antibody can be used for various applications in Life Sciences, including research on TGF-beta signaling pathways, epidermal growth factor regulation, and the interaction between IGFBP3 and other proteins such as transferrin or streptavidin.
MX1 antibody
The MX1 antibody is a biomolecule used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the antigen known as TRPV4. This antibody has been extensively studied and proven to be effective in various applications, including research and diagnostics.
Helicobacter pylori antibody
Helicobacter pylori antibody is a molecular docking protein used in Life Sciences. It specifically targets the Helicobacter bacteria, which is known to cause various gastrointestinal diseases. This antibody has been extensively studied and proven to have a high affinity for H. pylori antigens, making it an effective tool for research and diagnostic purposes. Additionally, it has been shown to inhibit the chemokine production by H. pylori, thereby reducing inflammation caused by the bacteria. The antibody can be immobilized on surfaces such as ferritin or glycopeptide for use in assays or diagnostic tests. Monoclonal Antibodies with specific glycosylation patterns are available, allowing researchers to target different epitopes of the bacteria. Furthermore, this antibody has shown potential as a therapeutic agent against H. pylori infections by inhibiting its growth factor TGF-beta and phosphatase activity. Overall, Helicobacter pylori antibody is a valuable tool in the fight against H. pylori-related diseases
MUC1 antibody
MUC1 antibody was raised in hamster using a synthetic peptide corresponding to aa 239-255 (SSLSYTNPAVAATSANL) form the cytoplasmic tail of MUC1 as the immunogen.
Purity:Min. 95%Mouse anti Human IgG (DY649)
Mouse anti-human IgG (DY649) was raised in mouse using human IgG as the immunogen.ApoC2 antibody
The ApoC2 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is commonly utilized in solid phase assays to detect and quantify ApoC2, a protein involved in lipid metabolism. This antibody has a high affinity for ApoC2 and can be used in various research applications, including studying the role of ApoC2 in lipid transport and metabolism disorders.Purity:Min. 95%Z-DNA antibody
Z-DNA antibody was raised in sheep using brominated poly-(DG-DC)-left handed DNA (Z-DNA) complexed to methylated BSA as the immunogen.Purity:Min. 95%Actin antibody
Actin antibody was raised in mouse using purified chicken gizzard actin as the immunogen.Rabbit anti Human IgE
Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.
Purity:Min. 95%Transferrin antibody
Transferrin antibody was raised in goat using purified human transferrin as the immunogen.
Purity:Min. 95%UCP2 antibody
UCP2 antibody was raised in rabbit using a 13 amino acid peptide from mouse UCP2 as the immunogen.
Purity:Min. 95%PrP 27-30 antibody
PrP 27-30 antibody was raised in goat using peptide (GQGGGTHSQWNKPSKPKTN) as the immunogen.Purity:Min. 95%HIV1 tat antibody
HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.
CKMM antibody
CKMM antibody was raised in rabbit using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.
Purity:Min. 95%Collagen Type IV antibody
Collagen type IV antibody was raised in rabbit using human placenta type IV collagen as the immunogen.Purity:Min. 95%PGS1 antibody
PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP
Purity:Min. 95%NMDAR2B antibody
The NMDAR2B antibody is a highly effective medicament used in Life Sciences. It belongs to the class of antibodies and is specifically designed to target and neutralize the NMDAR2B receptor. This receptor plays a crucial role in various physiological processes, including synaptic plasticity and learning. The NMDAR2B antibody works by binding to the receptor's amino-terminal domain, preventing its activation and subsequent signaling.
TGF alpha antibody
TGF alpha antibody was raised in sheep using mature human recombinant TGF-KLH as the immunogen.
Purity:Min. 95%IL6 antibody
The IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory processes. This antibody has been designed to neutralize the activity of IL-6, thereby reducing inflammation and its associated symptoms. The IL6 antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for conditions characterized by excessive IL-6 production, such as autoimmune diseases and certain types of cancer. This antibody is highly specific and does not cross-react with other cytokines or proteins, ensuring targeted and effective treatment. With its unique mechanism of action and high affinity for IL-6, the IL6 antibody holds great promise for improving patient outcomes in a wide range of inflammatory disorders.Transferrin antibody
Transferrin antibody was raised in mouse using placental transferrin receptor or transferrin as the immunogen.Ovomucoid antibody
Ovomucoid antibody is a cytotoxic growth factor that is commonly used in Life Sciences research. It is a polyclonal antibody that specifically targets ovomucoid, a steroid found in egg whites. This antibody has been shown to inhibit the growth of flavobacterium heparinum, a bacterium associated with infections in humans. Additionally, ovomucoid antibody can be used as a DNA aptamer to specifically bind and detect ovomucoid in biological samples. It is widely used in research settings to study the function and regulation of ovomucoid, as well as for diagnostic purposes. Ovomucoid antibody can also be produced as a monoclonal antibody or low-molecular-weight antibody for more specific applications. Furthermore, it has been shown to have colony-stimulating activity similar to GM-CSF (granulocyte-macrophage colony-stimulating factor), making it an important tool in immunology research.
