Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Legionella pneumophila antibody
Legionella pneumophila antibody was raised in mouse using Legionella pneumophila as the immunogen.
hPL antibody
The hPL antibody is a highly specialized Monoclonal Antibody that is activated and used in Life Sciences research. It is designed to specifically target and bind to the drug antibody present in human hepatocytes. This antibody has cytotoxic properties, making it an effective tool for studying the effects of drugs on liver cells. Additionally, the hPL antibody is reactive towards glycan, carbonic, natriuretic, and glycoprotein targets, making it a versatile tool for various research applications. Its high specificity and affinity make it an ideal choice for researchers looking to study the role of these targets in different biological processes. Furthermore, this antibody has been shown to have inhibitory effects on TGF-beta1 signaling pathway, providing valuable insights into its role in cell growth and development.AAV VP1 antibody
The AAV VP1 antibody is a low-density monoclonal antibody that has antiangiogenic properties. It is used in Life Sciences research to study endothelial growth and angiogenesis. This antibody specifically targets the VP1 protein of adeno-associated virus (AAV) and inhibits its activity. The AAV VP1 antibody has been shown to block the nuclear translocation of VP1 and prevent its interaction with cellular factors involved in angiogenesis. Additionally, this antibody has been used to detect glycosylation and glycation patterns of proteins in human serum samples. Its high specificity and sensitivity make it a valuable tool for studying protein-protein interactions and signaling pathways related to cell growth and apoptosis.
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3-oxime albumin as the immunogen.
EIF3M antibody
EIF3M antibody was raised using the N terminal of EIF3M corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
HBcAg antibody
The HBcAg antibody is a monoclonal antibody that belongs to the group of colony-stimulating antibodies. It specifically targets the hepatitis B core antigen (HBcAg) and has been extensively used in life sciences research. This antibody has shown strong binding affinity towards HBcAg, making it an effective tool for detecting and studying the antigen in various experimental settings.Estradiol 6,17 beta antibody
Estradiol 6,17 b antibody was raised in rabbit using Estradiol-17 beta-6-CMO-BSA as the immunogen.
Purity:Min. 95%Cystatin C antibody
The Cystatin C antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CXCR4 protein, which plays a crucial role in cell signaling and immune response. The antibody can be used for various applications, such as neutralizing CXCR4 activity, studying TNF-α and growth factor interactions, and investigating the effects of activated adalimumab on chemokine receptors.Ebola Virus antibody
The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.
Myoglobin antibody
Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.Purity:Min. 95%Progesterone 3 antibody
Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.
Purity:With Sensitivity ToHelicobacter pylori antibody
Helicobacter pylori antibody was raised in rabbit using ATCC strain 43504 as the immunogen.Purity:Min. 95%Myoglobin antibody
Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.
Bimagrumab
CAS:Human monoclonal antibody targeting activin receptor type-2B; treatment of muscle loss and weakness
PSA antibody
The PSA antibody is a highly effective tool for life sciences research. It is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA). This antibody has been extensively studied and validated for its high affinity and specificity towards PSA. It can be used in various applications such as immunohistochemistry, western blotting, ELISA, and flow cytometry. The PSA antibody has been shown to have inhibitory effects on c-myc and annexin, two proteins involved in cell proliferation and apoptosis regulation. It can also be used as an electrode in hybridization assays to detect the presence of PSA in biological samples. Furthermore, this antibody has neutralizing properties against PSA, making it an excellent tool for studying the role of PSA in cancer development and progression. Its use in therapeutic applications is also being explored. The PSA antibody is formulated with high-quality excipients to ensure stability and optimal performance. Streptavidin conjugates are available for enhanced detection when using biotinylated secondary antibodies
Purity:Min. 95%Oportuzumab Monatox
CAS:Antibody-drug conjugate (ADC) a humanized scFv specific for the epithelial cell adhesion molecule, Ep-CAM and a truncated portion of Pseudomonas exotoxin A.
E.Coli antibody (K99 Pilus)
Please enquire for more information about E.Coli antibody (K99 Pilus) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Lysozyme antibody
Lysozyme antibody was raised in rabbit using full length protein corresponding to amino acids 1-129 of Hen Egg White lysozyme as the immunogen.Purity:Min. 95%Intrinsic Factor antibody
Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.
Estrone 6 antibody
Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.
Purity:Min. 95%HIV1 p24 antibody
HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.
Purity:Min. 95%EGF antibody
EGF antibody was raised in goat using E. coli derived recombinant human EGF as the immunogen.
Purity:Min. 95%E.Coli antibody (K99 Pilus)
Please enquire for more information about E.Coli antibody (K99 Pilus) including the price, delivery time and more detailed product information at the technical inquiry form on this page
CRP antibody
CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.
SV2A antibody
SV2A antibody was raised using the middle region of SV2A corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTPurity:Min. 95%C Peptide antibody
C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.
Human IgA Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication.
Goat anti Rat IgG (H + L) (biotin)
Goat anti-rat IgG (H+L) (biotin) was raised in goat using rat IgG whole molecule as the immunogen.Purity:Min. 95%HIV1 p24 antibody (biotin)
HIV1 p24 antibody (biotin) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
Prolactin antibody
Prolactin antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to prolactin, a hormone involved in various physiological processes. This antibody can be used in experiments to study the role of prolactin in different cell types, such as granulosa cells. The antibody forms a complex with prolactin, allowing researchers to detect and measure the levels of prolactin in samples using techniques like ELISA or Western blotting. Additionally, this monoclonal antibody has neutralizing properties, meaning it can inhibit the biological activity of prolactin. The Prolactin antibody is an essential tool for scientists investigating the functions and mechanisms of this important hormone.Befovacimab
CAS:Human monoclonal antibody targeting tissue factor pathway inhibitor (TFPI); non-replacement therapy for haemophilia A/B patients
Mouse anti Human IgG2 (Fab)
Human IgG2 antibody (Fab) was raised in mouse using human IgG2 (Fab portion) as the immunogen.
Glucagon antibody
Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.
Purity:Min. 95%Human IgM antibody
The Human IgM antibody is a monoclonal antibody that plays a crucial role in the immune system. It is responsible for neutralizing pathogens and activating other immune cells to fight against infections. This antibody has been shown to have potent antiviral activity, particularly against viruses like influenza and HIV. Additionally, it has been found to inhibit the growth of cancer cells by targeting specific receptors involved in cell proliferation. The Human IgM antibody also possesses nephrotoxic properties, which can be utilized in certain therapeutic applications. Furthermore, this antibody has been studied for its potential as a diagnostic tool for autoimmune diseases, as it can detect the presence of autoantibodies in patient samples. Overall, the Human IgM antibody is a versatile and powerful tool in immunology research and clinical applications.VEGFR2 single chain antibody
VEGFR2 single chain antibody was raised in E.coli using Highly purified human sVEGFR-2/KDR as the immunogen.
Buprenorphine antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.Kanamycin antibody
The Kanamycin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to kanamycin, a widely used antibiotic. This antibody has been extensively tested and validated for its high specificity and sensitivity in various research applications.Purity:Min. 95%
