Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Goat anti Human IgE
Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.
Purity:Min. 95%Goat anti Rabbit IgG
Goat anti rabbit IgG was raised in goat using rabbit IgG as the immunogen.
Purity:Min. 95%CKBB antibody
CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.
Purity:Min. 95%HIV1 p24 antibody (biotin)
HIV1 p24 antibody (biotin) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.
HEXIM1 antibody
HEXIM1 antibody was raised in mouse using recombinant Human Hexamethylene Bis-Acetamide Inducible 1TNP antibody
The TNP antibody is a polyclonal antibody that specifically targets TGF-beta, a growth factor involved in various biological processes. This antibody has been shown to neutralize the activity of TGF-beta and inhibit its signaling pathway. Additionally, the TNP antibody can bind to alpha-fetoprotein and c-myc, two other important proteins involved in cellular growth and differentiation. This antibody is highly specific and has been extensively tested for its efficacy in various experimental models. It can be used as a research tool to study the role of TGF-beta in adipose tissue development, as well as in cancer progression and metastasis. The TNP antibody is available as both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high affinity and specificity, this antibody is an invaluable tool for studying the complex interactions between growth factors and their receptors.
ApoB antibody
ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.
Purity:Min. 95%UCP2 antibody
UCP2 antibody was raised in rabbit using a 13 amino acid peptide from mouse UCP2 as the immunogen.
Purity:Min. 95%SAA antibody
The SAA antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. It has been extensively studied and proven to be effective in ultrasensitive detection of biomolecules. The SAA antibody works by binding to specific target molecules, such as collagen, that are reactive in human serum. This binding can be detected using techniques like electrochemical impedance spectroscopy or chromatographic methods. The SAA antibody is a valuable tool for researchers and scientists working in biomolecular research, as it allows for accurate and reliable detection of activated biomolecules. Whether you're studying protein-protein interactions or analyzing complex biological samples, the SAA antibody offers high sensitivity and specificity for your research needs.Purity:Min. 95%Glucagon antibody
Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.
Purity:Min. 95%CA 125 antibody
CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascitic fluid as the immunogen.Rabbit MAb to Group A Streptococcus
Potentially suitable for ELISA, lateral Flow, ChLIA and other applications. This antibody will self-pair and can be used as both capture and label elements in immunoassay.
Purity:Min. 95%Color and Shape:PowderAnti-p21 antibody - 1mg/mL
The multi-functional cyclin-dependent kinase (CDK) inhibitor p21, also known as p21WAF1/Cip1 or CDKN1A functions as a cell cycle inhibitor and anti-proliferative effector. Upon DNA damage and genotoxic stress, the tumour suppressor p53 is activated and induces the expression of p21. p21 has also been implicated in nucleotide excision repair (NER), base excision repair (BER) and DNA translesion synthesis (TLS) by disrupting the proliferating cell nuclear antigen (PCNA) interaction with other DNA repair factors and promoting PCNA degradation.
Color and Shape:PowderGoat anti Human IgG (HRP) (gamma chain specific)
Goat anti-human IgG (HRP) (gamma chain specific) was raised in goat using human IgG as the immunogen.ApoB antibody
ApoB antibody was raised in goat using apolipoprotein B (hLDL) as the immunogen.
Purity:Min. 95%HBcAg antibody
HBcAg antibody is an antigen-specific monoclonal antibody that plays a crucial role in various life science applications. It is commonly used in immunohistochemistry and other research studies to detect the presence of HBcAg (hepatitis B core antigen) in biological samples. This antibody specifically targets and binds to HBcAg, allowing for accurate detection and analysis. The HBcAg antibody has been extensively tested and validated for its high specificity and sensitivity. It exhibits minimal cross-reactivity with other antigens, ensuring reliable results. Its superior performance makes it an essential tool for researchers studying hepatitis B virus (HBV) infection, as well as those investigating the development of potential therapeutic interventions. In addition to its use in research, the HBcAg antibody also holds promise in clinical applications. Its ability to selectively bind to HBcAg opens up possibilities for diagnostic tests and targeted therapies for hepatitis B patients. Furthermore, this antibody has shown potential in the field of cardiology, where it can be
Salmonella antibody (LPS core)
Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.
Anti-Ptgdr2 antibody - 0.5mg/mL
Prostaglandin D2 ligand activates G-protein-coupled receptors encoded by Ptgdr2, notably CRTh2, which mediate type 2 cytokine production, apoptosis inhibition and pro-inflammatory chemotaxis of Th2 cells, basophils and eosinophils, making the PGD2-CRTh2 pathway a vital factor in the regulation of allergic inflammation. Single nucleotide polymorphisms within the 3' UTR of the Ptgdr2 gene have been linked to asthma susceptibility, while Ptgdr2 signalling has been associated with self-renewal limitation of gastric cancer cells._x000D_
_x000D_
The prostaglandin D and prostaglandin D2 receptor CRTh2 is a chemoattractant receptor homologue that, along with two of its known isoforms, belongs to the G-protein-coupled leukocyte chemoattractant receptor family. Under PGD2 ligation signals, CRTh2, D-prostanoid (DP1) and thromboxane prostanoid (TP) signals are thought to mediate the biological action of prostaglandin D2 through stimulating calcium release from intracellular stores.hCG alpha antibody
hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.
Purity:Min. 95%Human Growth Hormone antibody
The Human Growth Hormone antibody is a glycosylated protein that plays a crucial role in endothelial growth and development. It acts as a growth factor and interacts with androgen receptors to regulate various physiological processes. The antibody specifically targets the human growth hormone, inhibiting its activity and preventing excessive growth.PGS1 antibody
PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP
Purity:Min. 95%Serotonin antibody
Serotonin antibody was raised in sheep using serotonin-Tg as the immunogen.
Purity:Min. 95%Anti-SLIT2 antibody - 1mg/mL
SLIT genes encode the secreted ligands used for regulation of axon branching, pathfinding and neuronal migration. The secretory protein Slit homolog 2 (Slit2) and its transmembrane receptor protein Robo1 are evolutionarily conserved molecules thought to regulate axon guidance and neuronal cell migration._x000D_ Roundabout homologue 1 (Robo1) is the major Slit2 receptor, used to mediate the function of Slit homologue proteins needed for guiding major forebrain projections during neuronal development. Secreted Slit2 proteins mediate chemorepulsive signals on cells expressing robo1 receptors, allowing the normal growth and migrations of axons in the developing brain. Robo2 is also a receptor protein for the ligand Slit1, with these receptor-ligand interactions being necessary for proper ganglion formation._x000D_ Although primarily known for involvement in neuronal signalling, Slit/Robo signalling is involved in cell proliferation and cell mortality in a range of cell and tissue types.PTDSS2 antibody
PTDSS2 antibody was raised in rabbit using the N terminal of PTDSS2 as the immunogenPurity:Min. 95%SIV mac251 gp120 antibody (biotin)
Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen
Factor V antibody (HRP)
Factor V antibody (HRP) was raised in sheep using human factor V purified from plasma as the immunogen.MX1 antibody
The MX1 antibody is a biomolecule used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the antigen known as TRPV4. This antibody has been extensively studied and proven to be effective in various applications, including research and diagnostics.
Leptin antibody
Leptin antibody was raised in goat using highly pure recombinant rat leptin as the immunogen.
Purity:Min. 95%VEGFR2 antibody
The VEGFR2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It acts as an inhibitor, targeting the vascular endothelial growth factor receptor 2 (VEGFR2). This antibody has been extensively tested and validated for its specificity and reliability. It can be used in various applications, such as immunoassays, western blotting, and immunohistochemistry.
Purity:Min. 95%CXCL1 antibody
The CXCL1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and inhibit the activity of CXCL1, a protein involved in various biological processes such as inflammation and immune response. This antibody recognizes specific epitopes on CXCL1, allowing for precise targeting and blocking of its function.
DHEA 7 Sulfate antibody
DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.
Purity:Min. 95%Placental Lactogen antibody
Placental lactogen antibody was raised in rabbit using human placental lactogen as the immunogen.
Purity:Min. 95%
