Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Goat anti Rabbit IgG
Goat anti rabbit IgG was raised in goat using rabbit IgG as the immunogen.
Purity:Min. 95%Goat anti Bovine IgG (H + L) (Alk Phos)
Goat anti-bovine IgG (H+L) (Alk Phos) was raised in goat using bovine IgG as the immunogen.
Amphetamine antibody
Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.
Purity:Min. 95%CD8 antibody
The CD8 antibody is a highly specialized monoclonal antibody that targets the glycoprotein CD8 on the surface of cytotoxic T cells. This antibody has been widely used in various life science research applications, including immunoassays and flow cytometry.
Influenza A antibody
Influenza A antibody was raised in mouse using nucleoproein of influenze A virus as the immunogen.Progesterone-17-OH antibody
Progesterone 17-OH antibody was raised in rabbit using 17-OH-Progesterone-3-CMO-BSA as the immunogen.
Purity:Min. 95%HSV1 + HSV2 ICP35 antibody
HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.
Chlamydia Abortus Elementary and Reticular Bodies Antigen
Chlamydia Abortus Elementary and Reticular Bodies Antigen is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about Chlamydia Abortus Elementary and Reticular Bodies Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.
TNP antibody
The TNP antibody is a polyclonal antibody that specifically targets TGF-beta, a growth factor involved in various biological processes. This antibody has been shown to neutralize the activity of TGF-beta and inhibit its signaling pathway. Additionally, the TNP antibody can bind to alpha-fetoprotein and c-myc, two other important proteins involved in cellular growth and differentiation. This antibody is highly specific and has been extensively tested for its efficacy in various experimental models. It can be used as a research tool to study the role of TGF-beta in adipose tissue development, as well as in cancer progression and metastasis. The TNP antibody is available as both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high affinity and specificity, this antibody is an invaluable tool for studying the complex interactions between growth factors and their receptors.
PGS1 antibody
PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP
Purity:Min. 95%Progesterone 11 antibody
Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.
Purity:Min. 95%VEGF antibody
VEGF antibody was raised in mouse using highly pure recombinant human VEGF165 as the immunogen.Cry1Ab antibody
The Cry1Ab antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets a molecule known as Cry1Ab, which is a growth factor derivative. This antibody has been shown to inhibit the function of Cry1Ab, leading to disruptions in iron homeostasis and affecting the levels of proteins such as ferritin, fibrinogen, globulin, collagen, and hepatocyte growth factor. Additionally, this monoclonal antibody has demonstrated binding capabilities to other targets such as steroids and influenza hemagglutinin. Its high specificity and affinity make it an excellent tool for research purposes in studying the effects of Cry1Ab on various biological processes.CKMM antibody
CKMM antibody was raised in mouse using CK-MM purified from human smooth muscle as the immunogen.Insulin antibody
Insulin antibody was raised in mouse using biosynthetic human insulin as the immunogen.EGFR antibody
The EGFR antibody is a highly specialized product in the field of Life Sciences. This polyclonal antibody targets the epidermal growth factor receptor (EGFR), which plays a crucial role in cell signaling and proliferation. By binding to EGFR, this antibody inhibits the activation of downstream pathways, leading to the suppression of cell growth and division.
hCG beta antibody
hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.
Purity:Min. 95%ApoB antibody
ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.
Bacillus anthracis (Anthrax) antibody
Bacillus anthracis (anthrax) antibody was raised in mouse using protective antigen of Bacillus anthracis as the immunogen.
Purity:Min. 95%Bacillus anthracis antibody (Edema Factor)
Polyclonal Bacillus anthracis antibody (Edema Factor), Anti-Bacillus anthracis antibody (Edema Factor), Bacillus anthracis EF antibody, Anthrax EF antibody, Bacillus anthracis Edema Factor antibody, Anthrax Edema Factor antibody
Buprenorphine antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.Factor VIII antibody
Factor Vlll antibody was raised in mouse using purified human factor VIII as the immunogen.
E. coli O157 antibody
E. coli O157 antibody was raised in mouse using the 'O' antigen of E. coli serotype O157 as the immunogen.CD4 antibody
CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.
Purity:Min. 95%Goat anti Human IgM
Goat anti-human IgM was raised in goat using human IgM mu chain as the immunogen.
Purity:Min. 95%Testosterone 11-beta-OH antibody
Testosterone antibody was raised in sheep using 11-beta hydroxytestosterone as the immunogen.
Purity:Min. 95%Salmonella antibody (LPS core)
Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.
Vaccinia virus antibody (FITC)
Vaccinia virus antibody (FITC) was raised in rabbit using new york city board of health (NYCBOH) strain, Vaccinia (whole virus) as the immunogen.
