Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
S100 antibody
S100 antibody was raised in mouse using purified bovine brain S100 protein as the immunogen.
Factor VIII antibody
Factor VIII antibody was raised in mouse using purified human factor VIII as the immunogen.TSNAX antibody
TSNAX antibody was raised in mouse using recombinant Human Translin-Associated Factor X
ApoB antibody
ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.
MUC2 antibody
The MUC2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies, which are widely used in various research and diagnostic applications. This particular antibody targets the MUC2 protein, which is involved in the regulation of mucin production. The MUC2 antibody acts as a potent inhibitor of CYP2A6, an enzyme responsible for the metabolism of certain drugs and toxins in the body. By inhibiting this enzyme, the antibody can enhance the effectiveness of medications that are metabolized by CYP2A6. In addition to its role as a protein inhibitor, the MUC2 antibody has been shown to have other therapeutic properties. It has been found to reduce microvessel density, which is important in limiting tumor growth and metastasis. The antibody also modulates the activity of growth factors and globulins, further contributing to its potential as a medicament. Furthermore, studies have demonstrated that the MUC2 antibody can
Estradiol antibody
Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.
HIV1 p24 antibody (biotin)
HIV1 p24 antibody (biotin) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
V5 Tag antibody
V5 Tag antibody was raised in mouse using GKPIPNPLLGLDST (V5) synthetic peptide conjugated to KLH as the immunogen.CA 15-3 antibody
CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.
Triiodothyronine antibody
Triiodothyronine antibody was raised in mouse using triiodothyronine (T3)-BSA as the immunogen.ALAS1 antibody
ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
hCG beta antibody
hCG beta antibody was raised in goat using affinity purified hCG beta as the immunogen.
HBsAg antibody
HBsAg antibody was raised in mouse using highly purified hepatitis B surface antigen as the immunogen.Cyclosporin A antibody
Cyclosporin A antibody was raised in mouse using cyclosporin A as the immunogen.
IL6 antibody (biotin)
IL6 antibody (biotin) was raised in rabbit using highly pure recombinant rat IL-6 as the immunogen.HBsAg antibody
HBsAg antibody was raised in mouse using recombinant HBsAg of ayw subtype as the immunogen.
Goat anti Bovine IgG (H + L) (Alk Phos)
Goat anti-bovine IgG (H+L) (Alk Phos) was raised in goat using bovine IgG as the immunogen.
CD8 antibody
The CD8 antibody is a highly specialized monoclonal antibody that targets the glycoprotein CD8 on the surface of cytotoxic T cells. This antibody has been widely used in various life science research applications, including immunoassays and flow cytometry.
Cry1Ab antibody
The Cry1Ab antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets a molecule known as Cry1Ab, which is a growth factor derivative. This antibody has been shown to inhibit the function of Cry1Ab, leading to disruptions in iron homeostasis and affecting the levels of proteins such as ferritin, fibrinogen, globulin, collagen, and hepatocyte growth factor. Additionally, this monoclonal antibody has demonstrated binding capabilities to other targets such as steroids and influenza hemagglutinin. Its high specificity and affinity make it an excellent tool for research purposes in studying the effects of Cry1Ab on various biological processes.Transferrin antibody
Transferrin antibody was raised in mouse using placental transferrin receptor or transferrin as the immunogen.HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.
Hemoglobin antibody
The Hemoglobin antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to hemoglobin, a glycoprotein found in red blood cells. This antibody has been extensively studied and proven to have neutralizing effects on the activity of hemoglobin, making it an invaluable resource for researchers studying hemoglobin-related diseases such as cryptosporidium infection.
Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in Mouse using LPS as the immunogen.
Free hCG β recombinant antibody
A recombinant monoclonal antibody derived from mouse monoclonal antibody to free Beta-hCG (clone M15294 expressed in HEK cell line).Human chorionic gonadotropin (hCG) is a hormone produced by the placenta during pregnancy and is commonly measured in blood or urine tests to confirm pregnancy.
SIV mac251 gp120 antibody
SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIV-1mac251) produced in baculovirus expression system as the immunogen.
Purity:Min. 95%Goat anti Human IgA (alpha chain)
Goat anti-Human IgA (alpha chain) was raised in goat using purified Human IgA as the immunogen.
Purity:Min. 95%IL6 antibody
The IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory processes. This antibody has been designed to neutralize the activity of IL-6, thereby reducing inflammation and its associated symptoms. The IL6 antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for conditions characterized by excessive IL-6 production, such as autoimmune diseases and certain types of cancer. This antibody is highly specific and does not cross-react with other cytokines or proteins, ensuring targeted and effective treatment. With its unique mechanism of action and high affinity for IL-6, the IL6 antibody holds great promise for improving patient outcomes in a wide range of inflammatory disorders.
