Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
BCAP31 antibody
BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Purity:Min. 95%Desmin antibody (Prediluted for IHC)
Rabbit polyclonal Desmin antibody (Prediluted for IHC)Purity:Min. 95%ELMO1 antibody
ELMO1 antibody was raised in rabbit using the C terminal of ELMO1 as the immunogen
Purity:Min. 95%GNS antibody
GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAPurity:Min. 95%ACSL1 antibody
ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYPurity:Min. 95%SLC26A1 antibody
SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAAPurity:Min. 95%Chymotrypsinogen B1 antibody
Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
Purity:Min. 95%TAF9 antibody
TAF9 antibody was raised in rabbit using the N terminal of TAF9 as the immunogenPurity:Min. 95%PEMT antibody
PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRSPurity:Min. 95%DNAJC19 antibody
DNAJC19 antibody was raised in rabbit using the C terminal of DNAJC19 as the immunogenPurity:Min. 95%SH3BP2 antibody
SH3BP2 antibody was raised using the middle region of SH3BP2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQPurity:Min. 95%SPON2 antibody
SPON2 antibody was raised using the N terminal of SPON2 corresponding to a region with amino acids CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWPurity:Min. 95%WNT2 antibody
WNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRPurity:Min. 95%HFE antibody
HFE antibody was raised using the C terminal of HFE corresponding to a region with amino acids FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPurity:Min. 95%ZNF674 antibody
ZNF674 antibody was raised in rabbit using the N terminal of ZNF674 as the immunogenPurity:Min. 95%GRIN2A antibody
GRIN2A antibody was raised using the middle region of GRIN2A corresponding to a region with amino acids DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDSTPurity:Min. 95%PCNA antibody (Prediluted for IHC)
Mouse monoclonal PCNA antibody (Prediluted for IHC)Purity:Min. 95%Zhx3 antibody
Zhx3 antibody was raised in rabbit using the c terminal of Zhx3 as the immunogenPurity:Min. 95%Paxillin antibody
The Paxillin antibody is a glycoprotein that belongs to the class of polyclonal antibodies. It is widely used in life sciences research for various applications. This antibody specifically targets TNF-α, a cytokine involved in inflammation and apoptosis. By binding to TNF-α, the Paxillin antibody can neutralize its activity and prevent downstream effects such as cell death. The Paxillin antibody has been extensively studied and has shown promising results in preclinical studies as a potential therapeutic agent for various diseases. It can be used in combination with other antibodies, such as adalimumab, to enhance its efficacy. Additionally, the Paxillin antibody has been used in diagnostic assays to detect the presence of TNF-α in patient samples. Its high specificity and sensitivity make it a valuable tool for researchers and clinicians alike.
Purity:Min. 95%PERP antibody
PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGPurity:Min. 95%CD137 antibody
CD137 antibody was raised in goat using highly pure recombinant human 4-1BB receptor as the immunogen.Purity:Min. 95%RP11-298P3.3 antibody
RP11-298P3.3 antibody was raised in rabbit using the middle region of RP11-298P3.3 as the immunogenPurity:Min. 95%PRDX5 antibody
PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIPurity:Min. 95%KCNH3 antibody
KCNH3 antibody was raised in rabbit using the N terminal of KCNH3 as the immunogenPurity:Min. 95%ZNF791 antibody
ZNF791 antibody was raised in rabbit using the N terminal of ZNF791 as the immunogenPurity:Min. 95%SLC12A8 antibody
SLC12A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYSPurity:Min. 95%Noggin antibody
Noggin antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Noggin protein as the immunogen.Purity:Min. 95%Calcitonin antibody (Prediluted for IHC)
Rabbit polyclonal Calcitonin antibody (Prediluted for IHC)Purity:Min. 95%ZNF610 antibody
ZNF610 antibody was raised in rabbit using the N terminal of ZNF610 as the immunogenPurity:Min. 95%PNN antibody
PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
Purity:Min. 95%SYVN1 antibody
SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVPurity:Min. 95%GABRR1 antibody
GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDHPurity:Min. 95%C6ORF21 antibody
C6ORF21 antibody was raised using the middle region of C6Orf21 corresponding to a region with amino acids LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR
Purity:Min. 95%TP53I13 antibody
TP53I13 antibody was raised in rabbit using the middle region of TP53I13 as the immunogen
Purity:Min. 95%WNT10B antibody
WNT10B antibody was raised using the middle region of WNT10B corresponding to a region with amino acids GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPurity:Min. 95%Kcnq2 antibody
Kcnq2 antibody was raised in rabbit using the middle region of Kcnq2 as the immunogenPurity:Min. 95%GALNTL4 antibody
GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVPurity:Min. 95%TECK antibody
TECK antibody was raised in rabbit using highly pure recombinant human TECK as the immunogen.Purity:Min. 95%CMA1 antibody
CMA1 antibody was raised in rabbit using the C terminal of CMA1 as the immunogenPurity:Min. 95%His Tag antibody
His tag antibody was raised in rabbit using chicken immunized with 6-HIS (HHHHHH) conjugated to KLH as the immunogen.Purity:Min. 95%His tag antibody
The His tag antibody is a hormone peptide used in Life Sciences. It acts as an anti-connexin agent and can bind to collagen. This antibody is commonly used in research and diagnostics. It is available in both polyclonal and monoclonal forms, allowing for a wide range of applications. The His tag antibody has glycan-binding properties, making it suitable for studying glycan structures. Additionally, it has neutralizing capabilities against certain targets and can be used as a neuroprotective agent. With its high specificity and affinity, the His tag antibody is a valuable tool in the field of molecular biology.Purity:Min. 95%Alirocumab
CAS:Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9
Purity:Min. 95%Color and Shape:LiquidPDGFRB antibody
PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Paxillin antibody
The Paxillin antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including cell adhesion, migration, and signaling. This antibody specifically targets paxillin, an important protein involved in the regulation of cell growth and movement.Purity:Min. 95%Rabbit anti Goat IgG (H + L) (Agarose Conjugated)
Rabbit anti goat IgG (H + L) (agarose conjugated) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%Rabbit anti Hamster IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.Purity:Min. 95%TOB1 antibody
TOB1 antibody was raised in rabbit using the middle region of TOB1 as the immunogenPurity:Min. 95%Goat anti Mouse IgG (H + L) (Fab'2) (HRP)
Goat anti-mouse IgG (H+L) (Fab'2) (HRP) was raised in goat using murine IgG whole molecule as the immunogen.Purity:Min. 95%Goat anti Human IgG (biotin)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%
